|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:ZFPM2-CHMP4C (FusionGDB2 ID:100423) |
Fusion Gene Summary for ZFPM2-CHMP4C |
Fusion gene summary |
Fusion gene information | Fusion gene name: ZFPM2-CHMP4C | Fusion gene ID: 100423 | Hgene | Tgene | Gene symbol | ZFPM2 | CHMP4C | Gene ID | 23414 | 92421 |
Gene name | zinc finger protein, FOG family member 2 | charged multivesicular body protein 4C | |
Synonyms | DIH3|FOG2|SRXY9|ZC2HC11B|ZNF89B|hFOG-2 | SNF7-3|Shax3|VPS32C | |
Cytomap | 8q23.1 | 8q21.13 | |
Type of gene | protein-coding | protein-coding | |
Description | zinc finger protein ZFPM2FOG-2Friend of GATA2friend of GATA 2friend of GATA protein 2transcription factor GATA4, modulator ofzinc finger protein 89Bzinc finger protein, multitype 2 | charged multivesicular body protein 4cSNF7 homolog associated with Alix 3Snf7 homologue associated with Alix 3chromatin modifying protein 4Cchromatin-modifying protein 4chSnf7-3hVps32-3vacuolar protein sorting-associated protein 32-3vps32-3 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | . | Q96CF2 | |
Ensembl transtripts involved in fusion gene | ENST00000407775, ENST00000520492, ENST00000517361, ENST00000522296, ENST00000378472, | ENST00000297265, | |
Fusion gene scores | * DoF score | 17 X 16 X 8=2176 | 2 X 1 X 2=4 |
# samples | 18 | 2 | |
** MAII score | log2(18/2176*10)=-3.59560974492067 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(2/4*10)=2.32192809488736 | |
Context | PubMed: ZFPM2 [Title/Abstract] AND CHMP4C [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | ZFPM2(106331209)-CHMP4C(82665299), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | ZFPM2 | GO:0045892 | negative regulation of transcription, DNA-templated | 20206639 |
Hgene | ZFPM2 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 10438528 |
Fusion gene breakpoints across ZFPM2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across CHMP4C (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | GBM | TCGA-41-3915-01A | ZFPM2 | chr8 | 106331209 | + | CHMP4C | chr8 | 82665299 | + |
Top |
Fusion Gene ORF analysis for ZFPM2-CHMP4C |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
In-frame | ENST00000407775 | ENST00000297265 | ZFPM2 | chr8 | 106331209 | + | CHMP4C | chr8 | 82665299 | + |
intron-3CDS | ENST00000520492 | ENST00000297265 | ZFPM2 | chr8 | 106331209 | + | CHMP4C | chr8 | 82665299 | + |
intron-3CDS | ENST00000517361 | ENST00000297265 | ZFPM2 | chr8 | 106331209 | + | CHMP4C | chr8 | 82665299 | + |
intron-3CDS | ENST00000522296 | ENST00000297265 | ZFPM2 | chr8 | 106331209 | + | CHMP4C | chr8 | 82665299 | + |
intron-3CDS | ENST00000378472 | ENST00000297265 | ZFPM2 | chr8 | 106331209 | + | CHMP4C | chr8 | 82665299 | + |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000407775 | ZFPM2 | chr8 | 106331209 | + | ENST00000297265 | CHMP4C | chr8 | 82665299 | + | 1773 | 290 | 250 | 801 | 183 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000407775 | ENST00000297265 | ZFPM2 | chr8 | 106331209 | + | CHMP4C | chr8 | 82665299 | + | 0.001854891 | 0.9981451 |
Top |
Fusion Genomic Features for ZFPM2-CHMP4C |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
ZFPM2 | chr8 | 106331209 | + | CHMP4C | chr8 | 82665298 | + | 1.72E-06 | 0.99999833 |
ZFPM2 | chr8 | 106331209 | + | CHMP4C | chr8 | 82665298 | + | 1.72E-06 | 0.99999833 |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for ZFPM2-CHMP4C |
Go to FGviewer for the breakpoints of chr8:106331209-chr8:82665299 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
. | CHMP4C |
FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). Key component of the cytokinesis checkpoint, a process required to delay abscission to prevent both premature resolution of intercellular chromosome bridges and accumulation of DNA damage: upon phosphorylation by AURKB, together with ZFYVE19/ANCHR, retains abscission-competent VPS4 (VPS4A and/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis. Deactivation of AURKB results in dephosphorylation of CHMP4C followed by its dissociation from ANCHR and VPS4 and subsequent abscission (PubMed:22422861, PubMed:24814515). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in HIV-1 p6- and p9-dependent virus release. CHMP4A/B/C are required for the exosomal release of SDCBP, CD63 and syndecan (PubMed:22660413). {ECO:0000269|PubMed:14505569, ECO:0000269|PubMed:14505570, ECO:0000269|PubMed:14519844, ECO:0000269|PubMed:22422861, ECO:0000269|PubMed:22660413, ECO:0000269|PubMed:24814515}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | CHMP4C | chr8:106331209 | chr8:82665299 | ENST00000297265 | 0 | 5 | 125_183 | 63.333333333333336 | 234.0 | Coiled coil | Ontology_term=ECO:0000255 |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ZFPM2 | chr8:106331209 | chr8:82665299 | ENST00000407775 | + | 1 | 8 | 736_740 | 13.333333333333334 | 1152.0 | Motif | Nuclear localization signal |
Hgene | ZFPM2 | chr8:106331209 | chr8:82665299 | ENST00000407775 | + | 1 | 8 | 1113_1146 | 13.333333333333334 | 1152.0 | Zinc finger | CCHC FOG-type 5 |
Hgene | ZFPM2 | chr8:106331209 | chr8:82665299 | ENST00000407775 | + | 1 | 8 | 244_277 | 13.333333333333334 | 1152.0 | Zinc finger | CCHC FOG-type 1 |
Hgene | ZFPM2 | chr8:106331209 | chr8:82665299 | ENST00000407775 | + | 1 | 8 | 296_320 | 13.333333333333334 | 1152.0 | Zinc finger | C2H2-type 1 |
Hgene | ZFPM2 | chr8:106331209 | chr8:82665299 | ENST00000407775 | + | 1 | 8 | 335_357 | 13.333333333333334 | 1152.0 | Zinc finger | C2H2-type 2 |
Hgene | ZFPM2 | chr8:106331209 | chr8:82665299 | ENST00000407775 | + | 1 | 8 | 363_385 | 13.333333333333334 | 1152.0 | Zinc finger | C2H2-type 3 |
Hgene | ZFPM2 | chr8:106331209 | chr8:82665299 | ENST00000407775 | + | 1 | 8 | 542_575 | 13.333333333333334 | 1152.0 | Zinc finger | CCHC FOG-type 2 |
Hgene | ZFPM2 | chr8:106331209 | chr8:82665299 | ENST00000407775 | + | 1 | 8 | 681_714 | 13.333333333333334 | 1152.0 | Zinc finger | CCHC FOG-type 3 |
Hgene | ZFPM2 | chr8:106331209 | chr8:82665299 | ENST00000407775 | + | 1 | 8 | 848_881 | 13.333333333333334 | 1152.0 | Zinc finger | CCHC FOG-type 4 |
Top |
Fusion Gene Sequence for ZFPM2-CHMP4C |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>In-frame_ENST00000407775_ENST00000297265_TCGA-41-3915-01A_ZFPM2_chr8_106331209_+_CHMP4C_chr8_82665299_length(transcript)=1773nt_BP=290nt CTCTCCCCCTCCCCTCCTCACTGTCACACTCTCTGTGCCCCCGTCTCTCTTCTCTCATTTGCTTGCTCATCTCCGAACGTGAATCCGCGG CTCCCGGAGGAGCCCAGCGCCCGGAGCACCTGGAGTCCGGCCGGCGGCGGGCCGAGCCTGGCCAGCGGCGGCGGCGGCGGCGGCGGCGGC GGGAGCCGAGGGAGCGGCAGCCGCGACCGCGGGCACCGCGGGAGCCCCAGCGGCAGCAGCCGCCGCCGAGATGTCCCGGCGAAAGCAAAG CAAACCCCGGCAGATCAAACCTGCATTACAGGCACTAAAGAGAAAGAAGAGGTTCGAGAAACAGCTCACTCAGATTGATGGCACACTTTC TACCATTGAGTTCCAGAGAGAAGCCCTGGAGAACTCACACACCAACACTGAGGTGTTGAGGAACATGGGCTTTGCAGCAAAAGCGATGAA ATCTGTTCATGAAAACATGGATCTGAACAAAATAGATGATTTGATGCAAGAGATCACAGAGCAACAGGATATCGCCCAAGAAATCTCAGA AGCATTTTCTCAACGGGTTGGCTTTGGTGATGACTTTGATGAGGATGAGTTGATGGCAGAACTTGAAGAATTGGAACAGGAGGAATTAAA TAAGAAGATGACAAATATCCGCCTTCCAAATGTGCCTTCCTCTTCTCTCCCAGCACAGCCAAATAGAAAACCAGGCATGTCGTCCACTGC ACGTCGATCCCGAGCAGCATCTTCCCAGAGGGCAGAAGAAGAGGATGATGATATCAAACAATTGGCAGCTTGGGCTACCTAAACTAAAAC ACATTTTTGATACCTAAATTAATGAGCTATAGATAAAATATAAAAAATGTTTTTACCAAGTTCAGAAGTTAACAAAGACTCTGCTTTATA ATTATATTGAATGAATAATTGTGTTTTAAGCCTCCTAAGTAAAAGTAAAAAAGGAGTCATGTGCATACATAGAATCAGTGATGGAGGCCA GGCACGGTATCTCATGCCTATAATCCCAGCACTTTGGGAGGCTGAGGCAGTTGAGACCAGGAGTTCGAGTCCAGCCTGACCAACATGAAG AAACCCTGTCTGTACTAAAAATACAAAAATTAGCCGGACATGGTGGCAGGCACCTGTAATCCCAGCTACTTGGGAGGCTGAGTCAGGAGA ATCGCTTGAGCCCAGGAGATGGAGGTTGCAGTGAGCCAAGATCATGCCACTGCACTCCAGACTGGGCAACAGAGGGAGACTCCGTCTCAA AAACTAAAAAAAAAAAATACATTTAGTATAGCGGGGGGTGGGGGGGAGAAATAATGTTATTTCCTATGCGAATGACGTGTATCCCTGTAC CCATGGTAAATGTAAATATACTGTGTCTCTTTTGGGAGAGCCTTTTAGTAGAGGAGTCTTATATGAGTCTCTACATAAGTAGTTTCACTT GAGTTTTGCAGTTTGAAATCTTAAAGGAGCTTTAATTGACATTTATTATACCAATTAAGCTTGGAATGGGGCAATGGATGCATTTCCCAA AACGTGTGAAAGCACTAACAGCTTATATTGCTGAATGAGAATCTCCTGGGTGTAATTTAGCCACTTAGGGAACTGCGTGAACACTCCCAG GCCATTATGATGCTGTTACAGCTTCAGTGTATAAATGCATGAGTATTCTTTCTGTTCTGTTTTGTGCTCTCTTGTACATTTATTTACCCT >In-frame_ENST00000407775_ENST00000297265_TCGA-41-3915-01A_ZFPM2_chr8_106331209_+_CHMP4C_chr8_82665299_length(amino acids)=183AA_start in transcript=250_stop in transcript=801 MSRRKQSKPRQIKPALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQD IAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAA -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for ZFPM2-CHMP4C |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Hgene | ZFPM2 | chr8:106331209 | chr8:82665299 | ENST00000407775 | + | 1 | 8 | 829_835 | 13.333333333333334 | 1152.0 | CTBP2 |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for ZFPM2-CHMP4C |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for ZFPM2-CHMP4C |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | ZFPM2 | C0039685 | Tetralogy of Fallot | 4 | CTD_human;GENOMICS_ENGLAND;ORPHANET;UNIPROT |
Hgene | ZFPM2 | C4015129 | 46,XY SEX REVERSAL 9 | 2 | CTD_human;GENOMICS_ENGLAND;UNIPROT |
Hgene | ZFPM2 | C0018054 | Gonadal Dysgenesis, 46,XY | 1 | GENOMICS_ENGLAND |
Hgene | ZFPM2 | C0019284 | Diaphragmatic Hernia | 1 | CTD_human |
Hgene | ZFPM2 | C0235833 | Congenital diaphragmatic hernia | 1 | ORPHANET |
Hgene | ZFPM2 | C1857586 | CONOTRUNCAL HEART MALFORMATIONS (disorder) | 1 | UNIPROT |
Hgene | ZFPM2 | C1857781 | Diaphragmatic Hernia 3 | 1 | CTD_human;GENOMICS_ENGLAND |
Hgene | ZFPM2 | C4510744 | 46,XY partial gonadal dysgenesis | 1 | ORPHANET |
Tgene | CHMP4C | C0919267 | ovarian neoplasm | 2 | CTD_human |
Tgene | CHMP4C | C1140680 | Malignant neoplasm of ovary | 2 | CTD_human |