|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:CCT3-CD5L (FusionGDB2 ID:14334) |
Fusion Gene Summary for CCT3-CD5L |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: CCT3-CD5L | Fusion gene ID: 14334 | Hgene | Tgene | Gene symbol | CCT3 | CD5L | Gene ID | 7203 | 922 |
| Gene name | chaperonin containing TCP1 subunit 3 | CD5 molecule like | |
| Synonyms | CCT-gamma|CCTG|PIG48|TCP-1-gamma|TRIC5 | AIM|API6|CT-2|PRO229|SP-ALPHA|Spalpha|hAIM | |
| Cytomap | 1q22 | 1q23.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | T-complex protein 1 subunit gammaT-complex protein 1, gamma subunitTCP1 (t-complex-1) ring complex, polypeptide 5chaperonin containing TCP1, subunit 3 (gamma)hTRiC5 | CD5 antigen-likeCD5 antigen-like (scavenger receptor cysteine rich family)apoptosis inhibitor 6apoptosis inhibitor expressed by macrophagesapoptosis inhibitor of macrophageigM-associated peptide | |
| Modification date | 20200327 | 20200313 | |
| UniProtAcc | P49368 | O43866 | |
| Ensembl transtripts involved in fusion gene | ENST00000295688, ENST00000368259, ENST00000368261, ENST00000472765, ENST00000368256, | ENST00000368174, ENST00000484609, | |
| Fusion gene scores | * DoF score | 24 X 18 X 12=5184 | 1 X 1 X 1=1 |
| # samples | 28 | 1 | |
| ** MAII score | log2(28/5184*10)=-4.21056698593966 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(1/1*10)=3.32192809488736 | |
| Context | PubMed: CCT3 [Title/Abstract] AND CD5L [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | CCT3(156280349)-CD5L(157803302), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | CCT3-CD5L seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. CCT3-CD5L seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Fusion gene breakpoints across CCT3 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Fusion gene breakpoints across CD5L (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | LIHC | TCGA-CC-A8HV-01A | CCT3 | chr1 | 156280349 | - | CD5L | chr1 | 157803302 | - |
Top |
Fusion Gene ORF analysis for CCT3-CD5L |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| Frame-shift | ENST00000295688 | ENST00000368174 | CCT3 | chr1 | 156280349 | - | CD5L | chr1 | 157803302 | - |
| 5CDS-intron | ENST00000295688 | ENST00000484609 | CCT3 | chr1 | 156280349 | - | CD5L | chr1 | 157803302 | - |
| Frame-shift | ENST00000368259 | ENST00000368174 | CCT3 | chr1 | 156280349 | - | CD5L | chr1 | 157803302 | - |
| 5CDS-intron | ENST00000368259 | ENST00000484609 | CCT3 | chr1 | 156280349 | - | CD5L | chr1 | 157803302 | - |
| In-frame | ENST00000368261 | ENST00000368174 | CCT3 | chr1 | 156280349 | - | CD5L | chr1 | 157803302 | - |
| 5CDS-intron | ENST00000368261 | ENST00000484609 | CCT3 | chr1 | 156280349 | - | CD5L | chr1 | 157803302 | - |
| Frame-shift | ENST00000472765 | ENST00000368174 | CCT3 | chr1 | 156280349 | - | CD5L | chr1 | 157803302 | - |
| 5CDS-intron | ENST00000472765 | ENST00000484609 | CCT3 | chr1 | 156280349 | - | CD5L | chr1 | 157803302 | - |
| intron-3CDS | ENST00000368256 | ENST00000368174 | CCT3 | chr1 | 156280349 | - | CD5L | chr1 | 157803302 | - |
| intron-intron | ENST00000368256 | ENST00000484609 | CCT3 | chr1 | 156280349 | - | CD5L | chr1 | 157803302 | - |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000368261 | CCT3 | chr1 | 156280349 | - | ENST00000368174 | CD5L | chr1 | 157803302 | - | 3134 | 1758 | 243 | 1772 | 509 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000368261 | ENST00000368174 | CCT3 | chr1 | 156280349 | - | CD5L | chr1 | 157803302 | - | 0.001371207 | 0.99862885 |
Top |
Fusion Genomic Features for CCT3-CD5L |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for CCT3-CD5L |
| Go to FGviewer for the breakpoints of chr1:156280349-chr1:157803302 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| CCT3 | CD5L |
| FUNCTION: Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of proteins upon ATP hydrolysis (PubMed:25467444). The TRiC complex mediates the folding of WRAP53/TCAB1, thereby regulating telomere maintenance (PubMed:25467444). As part of the TRiC complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia (PubMed:20080638). The TRiC complex plays a role in the folding of actin and tubulin (Probable). {ECO:0000269|PubMed:20080638, ECO:0000269|PubMed:25467444, ECO:0000305}. | FUNCTION: Secreted protein that acts as a key regulator of lipid synthesis: mainly expressed by macrophages in lymphoid and inflamed tissues and regulates mechanisms in inflammatory responses, such as infection or atherosclerosis. Able to inhibit lipid droplet size in adipocytes. Following incorporation into mature adipocytes via CD36-mediated endocytosis, associates with cytosolic FASN, inhibiting fatty acid synthase activity and leading to lipolysis, the degradation of triacylglycerols into glycerol and free fatty acids (FFA). CD5L-induced lipolysis occurs with progression of obesity: participates in obesity-associated inflammation following recruitment of inflammatory macrophages into adipose tissues, a cause of insulin resistance and obesity-related metabolic disease. Regulation of intracellular lipids mediated by CD5L has a direct effect on transcription regulation mediated by nuclear receptors ROR-gamma (RORC). Acts as a key regulator of metabolic switch in T-helper Th17 cells. Regulates the expression of pro-inflammatory genes in Th17 cells by altering the lipid content and limiting synthesis of cholesterol ligand of RORC, the master transcription factor of Th17-cell differentiation. CD5L is mainly present in non-pathogenic Th17 cells, where it decreases the content of polyunsaturated fatty acyls (PUFA), affecting two metabolic proteins MSMO1 and CYP51A1, which synthesize ligands of RORC, limiting RORC activity and expression of pro-inflammatory genes. Participates in obesity-associated autoimmunity via its association with IgM, interfering with the binding of IgM to Fcalpha/mu receptor and enhancing the development of long-lived plasma cells that produce high-affinity IgG autoantibodies (By similarity). Also acts as an inhibitor of apoptosis in macrophages: promotes macrophage survival from the apoptotic effects of oxidized lipids in case of atherosclerosis (PubMed:24295828). Involved in early response to microbial infection against various pathogens by acting as a pattern recognition receptor and by promoting autophagy (PubMed:16030018, PubMed:24223991, PubMed:24583716, PubMed:25713983). {ECO:0000250|UniProtKB:Q9QWK4, ECO:0000269|PubMed:16030018, ECO:0000269|PubMed:24223991, ECO:0000269|PubMed:24295828, ECO:0000269|PubMed:24583716, ECO:0000269|PubMed:25713983}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | CD5L | chr1:156280349 | chr1:157803302 | ENST00000368174 | 3 | 6 | 244_346 | 239.33333333333334 | 348.0 | Domain | SRCR 3 |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | CD5L | chr1:156280349 | chr1:157803302 | ENST00000368174 | 3 | 6 | 138_239 | 239.33333333333334 | 348.0 | Domain | SRCR 2 | |
| Tgene | CD5L | chr1:156280349 | chr1:157803302 | ENST00000368174 | 3 | 6 | 24_125 | 239.33333333333334 | 348.0 | Domain | SRCR 1 |
Top |
Fusion Gene Sequence for CCT3-CD5L |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >In-frame_ENST00000368261_ENST00000368174_TCGA-CC-A8HV-01A_CCT3_chr1_156280349_-_CD5L_chr1_157803302_length(transcript)=3134nt_BP=1758nt CTCTCTCCAGAAGGTTCTGCCGGTTCCCCCAGCTCTGGGTACCCGGCTCTGCATCGCGTCGCCATGATGGGCCATCGTCCAGTGCTCGTG CTCAAGACGGAGTTTCACCATGTTGACCAGGCTGGTCTCCAACTGCTGATGAGCTCAGGTGATCCGCCCACCTCGGCCTCCCAAAGTGCT GAGATTACAGGCGTGAGCCACCGCGCCCGGTCCCTTATTTTTTTCTGATGAGCACCACCTCCATTGTCTTCCTTTGGCCAGAACACAAAG CGTGAATCCGGAAGAAAAGTTCAATCTGGAAACATCAATGCTGCCAAGACTATTGCAGATATCATCCGAACATGTTTGGGACCCAAGTCC ATGATGAAGATGCTTTTGGACCCAATGGGAGGCATTGTGATGACCAATGATGGCAATGCCATTCTTCGAGAGATTCAAGTCCAGCATCCA GCGGCCAAGTCCATGATCGAAATTAGCCGGACCCAGGATGAAGAGGTTGGAGATGGGACCACATCAGTAATTATTCTTGCAGGGGAAATG CTGTCTGTAGCTGAGCACTTCCTGGAGCAGCAGATGCACCCAACAGTGGTGATCAGTGCTTACCGCAAGGCATTGGATGATATGATCAGC ACCCTAAAGAAAATAAGTATCCCAGTCGACATCAGTGACAGTGATATGATGCTGAACATCATCAACAGCTCTATTACTACCAAAGCCATC AGTCGGTGGTCATCTTTGGCTTGCAACATTGCCCTGGATGCTGTCAAGATGGTACAGTTTGAGGAGAATGGTCGGAAAGAGATTGACATA AAAAAATATGCAAGAGTGGAAAAGATACCTGGAGGCATCATTGAAGACTCCTGTGTCTTGCGTGGAGTCATGATTAACAAGGATGTGACC CATCCACGTATGCGGCGCTATATCAAGAACCCTCGCATTGTGCTGCTGGATTCTTCTCTGGAATACAAGAAAGGAGAAAGCCAGACTGAC ATTGAGATTACACGAGAGGAGGACTTCACCCGAATTCTCCAGATGGAGGAAGAGTACATCCAGCAGCTCTGTGAGGACATTATCCAACTG AAGCCCGATGTGGTCATCACTGAAAAGGGCATCTCAGATTTAGCTCAGCACTACCTTATGCGGGCCAATATCACAGCCATCCGCAGAGTC CGGAAGACAGACAATAATCGCATTGCTAGAGCCTGTGGGGCCCGGATAGTCAGCCGACCAGAGGAACTGAGAGAAGATGATGTTGGAACA GGAGCAGGCCTGTTGGAAATCAAGAAAATTGGAGATGAATACTTTACTTTCATCACTGACTGCAAAGACCCCAAGGCCTGCACCATTCTC CTCCGGGGGGCTAGCAAAGAGATTCTCTCGGAAGTAGAACGCAACCTCCAGGATGCCATGCAAGTGTGTCGCAATGTTCTCCTGGACCCT CAGCTGGTGCCAGGGGGTGGGGCCTCCGAGATGGCTGTGGCCCATGCCTTGACAGAAAAATCCAAGGCCATGACTGGTGTGGAACAATGG CCATACAGGGCTGTTGCCCAGGCCCTAGAGGTCATTCCTCGTACCCTGATCCAGAACTGTGGGGCCAGCACCATCCGTCTACTTACCTCC CTTCGGGCCAAGCACACCCAGGAGAACTGTGAGACCTGGGGTGTAAATGGTGAGACGGGTACTTTGGTGGACATGAAGGAACTGGGCATA TGGGAGCCATTGGCTGTGAAGCTGCAGACTTATAAGACAGCAGTGGAGATCCCTTTGACTTGAGACTAGTAGGAGGAGACAACCTCTGCT CTGGGCGACTGGAGGTGCTGCACAAGGGCGTATGGGGCTCTGTCTGTGATGACAACTGGGGAGAAAAGGAGGACCAGGTGGTATGCAAGC AACTGGGCTGTGGGAAGTCCCTCTCTCCCTCCTTCAGAGACCGGAAATGCTATGGCCCTGGGGTTGGCCGCATCTGGCTGGATAATGTTC GTTGCTCAGGGGAGGAGCAGTCCCTGGAGCAGTGCCAGCACAGATTTTGGGGGTTTCACGACTGCACCCACCAGGAAGATGTGGCTGTCA TCTGCTCAGGATAGTATCCTGGTGTTGCTTGACCTGGCCCCCCTGGCCCCGCCTGCCCTCTGCTTGTTCTCCTGAGCCCTGATTATCCTC ATACTCATTCTGGGGCTCAGGCTTGAGCCACTACTCCCTCATCCCCTCAGGAGTCTGAACACTGGGCTTATGCCTTACTCTCAGGGACAA GCAGCCCCCATTGCTGCCTGTAGATGTGAGCTGTTGAGTTCCCTCTTGCTGGGGAAGATGAGCTTCCATGTATCCTGTGCTCAACCCTGA CCCTTTGACACTGGTTCTGGCCTTTCCTGCCTTTTCTCAAGCTGCCTGGAATCCTCAAACCTGTCACTTTGGTCAGATGTGCAGACCATT ACTAAGGTCTATGTCTGCAAACATTACTAATCTAGGTCCTATTACTAATCTATGTCTGCAAACATTAAAGGAATGAAACAATGAAAGGAA CATTTGAAAGAAAATGTGGGTAGACAATTTCTTGCAACTTGGGGGAAAGTTTAGAATTCTTTTGATTGGACTACTTTTTTTTTTTTTCCT CAAGCTTCAGGTGACCACAATAGCAACACCTCCCTATTCTGTTATTTCTTAGTGTAGGTAGACAATTCTTTCAGGAGCAGAGCAGCGTCC TATAATCCTAGACCTTTTCATGACGTGTAAAAAATGATGTTTCATCCTCTGATTGCCCCAATAAAAATCTTTGTTGTCCATCCCTATACA ACCTGCCAACATGGTTGACATTTAATGAGAGGAATGTCAAAAATACATTTTACTTTATTCAAAGAAAAATATATTGGTTACTGGGAAAAG GTCAAGAAAGAGGCAGAAAGAGATCAGGGAGGGCTAAAGTTGTGTCTTATGCCAAGCGAAAGTGAAAAATATCATTTTCACTTTATCAAC TGAGACTTTGGGGCCTGTAAGCTTGAGGCAAGACAGAAATAAGAGAATCAAGACTTGATTGTAAAAATTGACAACTTTAGATTCTGAGGC >In-frame_ENST00000368261_ENST00000368174_TCGA-CC-A8HV-01A_CCT3_chr1_156280349_-_CD5L_chr1_157803302_length(amino acids)=509AA_start in transcript=243_stop in transcript=1772 MSSFGQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTT SVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFE ENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQ QLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDC KDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCG -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for CCT3-CD5L |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for CCT3-CD5L |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for CCT3-CD5L |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Hgene | CCT3 | C0019193 | Hepatitis, Toxic | 1 | CTD_human |
| Hgene | CCT3 | C0019693 | HIV Infections | 1 | CTD_human |
| Hgene | CCT3 | C0860207 | Drug-Induced Liver Disease | 1 | CTD_human |
| Hgene | CCT3 | C1262760 | Hepatitis, Drug-Induced | 1 | CTD_human |
| Hgene | CCT3 | C3658290 | Drug-Induced Acute Liver Injury | 1 | CTD_human |
| Hgene | CCT3 | C4277682 | Chemical and Drug Induced Liver Injury | 1 | CTD_human |
| Hgene | CCT3 | C4279912 | Chemically-Induced Liver Toxicity | 1 | CTD_human |
| Hgene | CCT3 | C4505456 | HIV Coinfection | 1 | CTD_human |
| Tgene | CD5L | C0023893 | Liver Cirrhosis, Experimental | 1 | CTD_human |
| Tgene | CD5L | C2239176 | Liver carcinoma | 1 | CTD_human |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies