|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:COMMD9-CD59 (FusionGDB2 ID:18560) |
Fusion Gene Summary for COMMD9-CD59 |
Fusion gene summary |
Fusion gene information | Fusion gene name: COMMD9-CD59 | Fusion gene ID: 18560 | Hgene | Tgene | Gene symbol | COMMD9 | CD59 | Gene ID | 29099 | 966 |
Gene name | COMM domain containing 9 | CD59 molecule (CD59 blood group) | |
Synonyms | C11orf55|HSPC166|LINC00610 | 16.3A5|1F5|EJ16|EJ30|EL32|G344|HRF-20|HRF20|MAC-IP|MACIF|MEM43|MIC11|MIN1|MIN2|MIN3|MIRL|MSK21|p18-20 | |
Cytomap | 11p13 | 11p13 | |
Type of gene | protein-coding | protein-coding | |
Description | COMM domain-containing protein 9 | CD59 glycoprotein1F5 antigen20 kDa homologous restriction factorCD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344)CD59 blood group antigenCD59 molecule, complement regulatory proteinLy-6-like protein | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q9P000 | P13987 | |
Ensembl transtripts involved in fusion gene | ENST00000263401, ENST00000452374, ENST00000532705, ENST00000533308, | ENST00000534312, ENST00000395850, ENST00000533403, ENST00000351554, ENST00000415002, ENST00000445143, ENST00000426650, ENST00000437761, ENST00000527577, ENST00000528700, | |
Fusion gene scores | * DoF score | 6 X 4 X 4=96 | 14 X 15 X 5=1050 |
# samples | 5 | 17 | |
** MAII score | log2(5/96*10)=-0.941106310946431 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(17/1050*10)=-2.62678267641578 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: COMMD9 [Title/Abstract] AND CD59 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | COMMD9(36300027)-CD59(33720060), # samples:3 | ||
Anticipated loss of major functional domain due to fusion event. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | CD59 | GO:0030449 | regulation of complement activation | 25284781 |
Tgene | CD59 | GO:1903659 | regulation of complement-dependent cytotoxicity | 25284781 |
Fusion gene breakpoints across COMMD9 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across CD59 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | SKCM | TCGA-FS-A1ZK-06A | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
ChimerDB4 | SKCM | TCGA-FS-A1ZK-06A | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
ChimerDB4 | SKCM | TCGA-FS-A1ZK-06A | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
Top |
Fusion Gene ORF analysis for COMMD9-CD59 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
In-frame | ENST00000263401 | ENST00000534312 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000263401 | ENST00000395850 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000263401 | ENST00000533403 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000263401 | ENST00000351554 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000263401 | ENST00000415002 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000263401 | ENST00000445143 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000263401 | ENST00000426650 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000263401 | ENST00000437761 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000263401 | ENST00000527577 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000263401 | ENST00000528700 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
In-frame | ENST00000452374 | ENST00000534312 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000452374 | ENST00000395850 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000452374 | ENST00000533403 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000452374 | ENST00000351554 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000452374 | ENST00000415002 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000452374 | ENST00000445143 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000452374 | ENST00000426650 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000452374 | ENST00000437761 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000452374 | ENST00000527577 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000452374 | ENST00000528700 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
In-frame | ENST00000532705 | ENST00000534312 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000532705 | ENST00000395850 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000532705 | ENST00000533403 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000532705 | ENST00000351554 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000532705 | ENST00000415002 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000532705 | ENST00000445143 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000532705 | ENST00000426650 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000532705 | ENST00000437761 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000532705 | ENST00000527577 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
5CDS-intron | ENST00000532705 | ENST00000528700 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
intron-3CDS | ENST00000533308 | ENST00000534312 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
intron-intron | ENST00000533308 | ENST00000395850 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
intron-intron | ENST00000533308 | ENST00000533403 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
intron-intron | ENST00000533308 | ENST00000351554 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
intron-intron | ENST00000533308 | ENST00000415002 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
intron-intron | ENST00000533308 | ENST00000445143 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
intron-intron | ENST00000533308 | ENST00000426650 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
intron-intron | ENST00000533308 | ENST00000437761 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
intron-intron | ENST00000533308 | ENST00000527577 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
intron-intron | ENST00000533308 | ENST00000528700 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000263401 | COMMD9 | chr11 | 36300027 | - | ENST00000534312 | CD59 | chr11 | 33720060 | - | 588 | 334 | 17 | 457 | 146 |
ENST00000452374 | COMMD9 | chr11 | 36300027 | - | ENST00000534312 | CD59 | chr11 | 33720060 | - | 482 | 228 | 37 | 351 | 104 |
ENST00000532705 | COMMD9 | chr11 | 36300027 | - | ENST00000534312 | CD59 | chr11 | 33720060 | - | 583 | 329 | 12 | 452 | 146 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000263401 | ENST00000534312 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - | 0.008381991 | 0.991618 |
ENST00000452374 | ENST00000534312 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - | 0.064446986 | 0.935553 |
ENST00000532705 | ENST00000534312 | COMMD9 | chr11 | 36300027 | - | CD59 | chr11 | 33720060 | - | 0.008735324 | 0.99126464 |
Top |
Fusion Genomic Features for COMMD9-CD59 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for COMMD9-CD59 |
Go to FGviewer for the breakpoints of chr11:36300027-chr11:33720060 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
COMMD9 | CD59 |
FUNCTION: May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes (PubMed:21778237). May down-regulate activation of NF-kappa-B (PubMed:15799966). Modulates Na(+) transport in epithelial cells by regulation of apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits (PubMed:23637203). {ECO:0000269|PubMed:15799966, ECO:0000269|PubMed:23637203, ECO:0000305|PubMed:21778237}. | FUNCTION: Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.; FUNCTION: The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | CD59 | chr11:36300027 | chr11:33720060 | ENST00000351554 | 0 | 5 | 26_108 | 0 | 129.0 | Domain | Note=UPAR/Ly6 | |
Tgene | CD59 | chr11:36300027 | chr11:33720060 | ENST00000395850 | 0 | 4 | 26_108 | 0 | 129.0 | Domain | Note=UPAR/Ly6 | |
Tgene | CD59 | chr11:36300027 | chr11:33720060 | ENST00000415002 | 0 | 3 | 26_108 | 0 | 129.0 | Domain | Note=UPAR/Ly6 | |
Tgene | CD59 | chr11:36300027 | chr11:33720060 | ENST00000426650 | 0 | 4 | 26_108 | 0 | 129.0 | Domain | Note=UPAR/Ly6 | |
Tgene | CD59 | chr11:36300027 | chr11:33720060 | ENST00000437761 | 0 | 4 | 26_108 | 0 | 129.0 | Domain | Note=UPAR/Ly6 | |
Tgene | CD59 | chr11:36300027 | chr11:33720060 | ENST00000445143 | 0 | 4 | 26_108 | 0 | 129.0 | Domain | Note=UPAR/Ly6 | |
Tgene | CD59 | chr11:36300027 | chr11:33720060 | ENST00000527577 | 0 | 5 | 26_108 | 0 | 129.0 | Domain | Note=UPAR/Ly6 | |
Tgene | CD59 | chr11:36300027 | chr11:33720060 | ENST00000528700 | 0 | 6 | 26_108 | 0 | 129.0 | Domain | Note=UPAR/Ly6 |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | COMMD9 | chr11:36300027 | chr11:33720060 | ENST00000263401 | - | 3 | 6 | 122_196 | 105.66666666666667 | 199.0 | Domain | COMM |
Hgene | COMMD9 | chr11:36300027 | chr11:33720060 | ENST00000452374 | - | 2 | 5 | 122_196 | 63.666666666666664 | 157.0 | Domain | COMM |
Top |
Fusion Gene Sequence for COMMD9-CD59 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>In-frame_ENST00000263401_ENST00000534312_TCGA-FS-A1ZK-06A_COMMD9_chr11_36300027_-_CD59_chr11_33720060_length(transcript)=588nt_BP=334nt CATGTGACTTCGGCAAGATGGCTGCCCTGACAGCGGAGCATTTTGCAGCACTCCAGAGCCTGCTCAAGGCCTCCTCGAAAGATGTTGTCA GACAGCTGTGTCAAGAAAGCTTTTCCAGTTCAGCCCTTGGCTTGAAAAAACTCTTGGATGTTACATGTTCCAGCTTGTCTGTGACCCAGG AGGAGGCAGAGGAACTGCTCCAGGCTCTGCACCGCCTCACTAGGCTGGTGGCATTCCGTGACCTGTCCTCTGCCGAGGCAATTCTGGCTC TCTTTCCAGAAAATTTCCACCAAAACCTCAAAAACCTGCTGACAAAGATCATCCTAGAACATGTACACATTCCTGAAGGCGCTAAAAGAC GAAAAGTTACAAGGACTGAAGACCAAGCAACCTGGAAAGAAGTCGGCCTCTCTCTCCTGAGGAGCTGCCTACCAGAGCTTGGGCAGCCAC CTCCTTAGGTGTTAGTGCTTAGATAATGTGTCCCATTTGTTGTCATTTCAAAGATGGTTATTTTCTGTTCTGTATTTACCGCTGTTCTTG >In-frame_ENST00000263401_ENST00000534312_TCGA-FS-A1ZK-06A_COMMD9_chr11_36300027_-_CD59_chr11_33720060_length(amino acids)=146AA_start in transcript=17_stop in transcript=457 MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENF -------------------------------------------------------------- >In-frame_ENST00000452374_ENST00000534312_TCGA-FS-A1ZK-06A_COMMD9_chr11_36300027_-_CD59_chr11_33720060_length(transcript)=482nt_BP=228nt GCTTCCCTGGGTGCCACGGTCATGTGACTTCGGCAAGATGGCTGCCCTGACAGCGGAGCATTTTGCAGCACTCCAGAGCCTGCTCAAGCT GCTCCAGGCTCTGCACCGCCTCACTAGGCTGGTGGCATTCCGTGACCTGTCCTCTGCCGAGGCAATTCTGGCTCTCTTTCCAGAAAATTT CCACCAAAACCTCAAAAACCTGCTGACAAAGATCATCCTAGAACATGTACACATTCCTGAAGGCGCTAAAAGACGAAAAGTTACAAGGAC TGAAGACCAAGCAACCTGGAAAGAAGTCGGCCTCTCTCTCCTGAGGAGCTGCCTACCAGAGCTTGGGCAGCCACCTCCTTAGGTGTTAGT GCTTAGATAATGTGTCCCATTTGTTGTCATTTCAAAGATGGTTATTTTCTGTTCTGTATTTACCGCTGTTCTTGTTGCTACCAGCATGTA >In-frame_ENST00000452374_ENST00000534312_TCGA-FS-A1ZK-06A_COMMD9_chr11_36300027_-_CD59_chr11_33720060_length(amino acids)=104AA_start in transcript=37_stop in transcript=351 MAALTAEHFAALQSLLKLLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVHIPEGAKRRKVTRTEDQATWKEVGLS -------------------------------------------------------------- >In-frame_ENST00000532705_ENST00000534312_TCGA-FS-A1ZK-06A_COMMD9_chr11_36300027_-_CD59_chr11_33720060_length(transcript)=583nt_BP=329nt GACTTCGGCAAGATGGCTGCCCTGACAGCGGAGCATTTTGCAGCACTCCAGAGCCTGCTCAAGGCCTCCTCGAAAGATGTTGTCAGACAG CTGTGTCAAGAAAGCTTTTCCAGTTCAGCCCTTGGCTTGAAAAAACTCTTGGATGTTACATGTTCCAGCTTGTCTGTGACCCAGGAGGAG GCAGAGGAACTGCTCCAGGCTCTGCACCGCCTCACTAGGCTGGTGGCATTCCGTGACCTGTCCTCTGCCGAGGCAATTCTGGCTCTCTTT CCAGAAAATTTCCACCAAAACCTCAAAAACCTGCTGACAAAGATCATCCTAGAACATGTACACATTCCTGAAGGCGCTAAAAGACGAAAA GTTACAAGGACTGAAGACCAAGCAACCTGGAAAGAAGTCGGCCTCTCTCTCCTGAGGAGCTGCCTACCAGAGCTTGGGCAGCCACCTCCT TAGGTGTTAGTGCTTAGATAATGTGTCCCATTTGTTGTCATTTCAAAGATGGTTATTTTCTGTTCTGTATTTACCGCTGTTCTTGTTGCT >In-frame_ENST00000532705_ENST00000534312_TCGA-FS-A1ZK-06A_COMMD9_chr11_36300027_-_CD59_chr11_33720060_length(amino acids)=146AA_start in transcript=12_stop in transcript=452 MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENF -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for COMMD9-CD59 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for COMMD9-CD59 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for COMMD9-CD59 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Tgene | CD59 | C2676767 | CD59 Deficiency | 4 | CTD_human;GENOMICS_ENGLAND;ORPHANET;UNIPROT |
Tgene | CD59 | C0024790 | Paroxysmal nocturnal hemoglobinuria | 1 | GENOMICS_ENGLAND |
Tgene | CD59 | C0272242 | Complement deficiency disease | 1 | GENOMICS_ENGLAND |
Tgene | CD59 | C1148551 | X-Linked Dyskeratosis Congenita | 1 | GENOMICS_ENGLAND |
Tgene | CD59 | C4727002 | Chronic Hemolysis | 1 | GENOMICS_ENGLAND |
Tgene | CD59 | C4755276 | Primary CD59 deficiency | 1 | GENOMICS_ENGLAND |