|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:CRIM1-LRPPRC (FusionGDB2 ID:19445) |
Fusion Gene Summary for CRIM1-LRPPRC |
Fusion gene summary |
Fusion gene information | Fusion gene name: CRIM1-LRPPRC | Fusion gene ID: 19445 | Hgene | Tgene | Gene symbol | CRIM1 | LRPPRC | Gene ID | 51232 | 10128 |
Gene name | cysteine rich transmembrane BMP regulator 1 | leucine rich pentatricopeptide repeat containing | |
Synonyms | CRIM-1|S52 | CLONE-23970|GP130|LRP130|LSFC | |
Cytomap | 2p22.2 | 2p21 | |
Type of gene | protein-coding | protein-coding | |
Description | cysteine-rich motor neuron 1 proteincysteine rich transmembrane BMP regulator 1 (chordin-like)cysteine-rich repeat-containing protein S52 | leucine-rich PPR motif-containing protein, mitochondrial130 kDa leucine-rich proteinLRP 130leucine-rich PPR-motif containingmitochondrial leucine-rich PPR motif-containing protein | |
Modification date | 20200313 | 20200329 | |
UniProtAcc | Q9NZV1 | P42704 | |
Ensembl transtripts involved in fusion gene | ENST00000280527, ENST00000473403, | ENST00000260665, ENST00000409946, ENST00000409659, | |
Fusion gene scores | * DoF score | 15 X 11 X 8=1320 | 13 X 13 X 4=676 |
# samples | 16 | 13 | |
** MAII score | log2(16/1320*10)=-3.04439411935845 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(13/676*10)=-2.37851162325373 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: CRIM1 [Title/Abstract] AND LRPPRC [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | CRIM1(36583766)-LRPPRC(44145537), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Fusion gene breakpoints across CRIM1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across LRPPRC (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | UCEC | TCGA-A5-A1OH | CRIM1 | chr2 | 36583766 | + | LRPPRC | chr2 | 44145537 | - |
Top |
Fusion Gene ORF analysis for CRIM1-LRPPRC |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
In-frame | ENST00000280527 | ENST00000260665 | CRIM1 | chr2 | 36583766 | + | LRPPRC | chr2 | 44145537 | - |
5CDS-intron | ENST00000280527 | ENST00000409946 | CRIM1 | chr2 | 36583766 | + | LRPPRC | chr2 | 44145537 | - |
5CDS-intron | ENST00000280527 | ENST00000409659 | CRIM1 | chr2 | 36583766 | + | LRPPRC | chr2 | 44145537 | - |
intron-3CDS | ENST00000473403 | ENST00000260665 | CRIM1 | chr2 | 36583766 | + | LRPPRC | chr2 | 44145537 | - |
intron-intron | ENST00000473403 | ENST00000409946 | CRIM1 | chr2 | 36583766 | + | LRPPRC | chr2 | 44145537 | - |
intron-intron | ENST00000473403 | ENST00000409659 | CRIM1 | chr2 | 36583766 | + | LRPPRC | chr2 | 44145537 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000280527 | CRIM1 | chr2 | 36583766 | + | ENST00000260665 | LRPPRC | chr2 | 44145537 | - | 4079 | 698 | 367 | 1986 | 539 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000280527 | ENST00000260665 | CRIM1 | chr2 | 36583766 | + | LRPPRC | chr2 | 44145537 | - | 0.000385693 | 0.99961424 |
Top |
Fusion Genomic Features for CRIM1-LRPPRC |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for CRIM1-LRPPRC |
Go to FGviewer for the breakpoints of chr2:36583766-chr2:44145537 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
CRIM1 | LRPPRC |
FUNCTION: May play a role in CNS development by interacting with growth factors implicated in motor neuron differentiation and survival. May play a role in capillary formation and maintenance during angiogenesis. Modulates BMP activity by affecting its processing and delivery to the cell surface. {ECO:0000269|PubMed:12464430, ECO:0000269|PubMed:12805376}. | FUNCTION: May play a role in RNA metabolism in both nuclei and mitochondria. In the nucleus binds to HNRPA1-associated poly(A) mRNAs and is part of nmRNP complexes at late stages of mRNA maturation which are possibly associated with nuclear mRNA export. May bind mature mRNA in the nucleus outer membrane. In mitochondria binds to poly(A) mRNA. Plays a role in translation or stability of mitochondrially encoded cytochrome c oxidase (COX) subunits. May be involved in transcription regulation. Cooperates with PPARGC1A to regulate certain mitochondrially encoded genes and gluconeogenic genes and may regulate docking of PPARGC1A to transcription factors. Seems to be involved in the transcription regulation of the multidrug-related genes MDR1 and MVP. Part of a nuclear factor that binds to the invMED1 element of MDR1 and MVP gene promoters. Binds single-stranded DNA (By similarity). {ECO:0000250, ECO:0000269|PubMed:11585913, ECO:0000269|PubMed:12832482, ECO:0000269|PubMed:15081402, ECO:0000269|PubMed:15139850, ECO:0000269|PubMed:15272088, ECO:0000269|PubMed:17050673}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CRIM1 | chr2:36583766 | chr2:44145537 | ENST00000280527 | + | 1 | 17 | 35_112 | 110.33333333333333 | 1037.0 | Domain | IGFBP N-terminal |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 1121_1394 | 965.3333333333334 | 1395.0 | Region | Note=RNA-binding | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 1121_1394 | 0 | 532.0 | Region | Note=RNA-binding | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 1031_1065 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 15 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 1066_1102 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 16 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 1103_1137 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 17 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 1138_1175 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 18 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 1176_1210 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 19 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 1317_1351 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 20 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 1031_1065 | 0 | 532.0 | Repeat | Note=PPR 15 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 1066_1102 | 0 | 532.0 | Repeat | Note=PPR 16 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 1103_1137 | 0 | 532.0 | Repeat | Note=PPR 17 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 1138_1175 | 0 | 532.0 | Repeat | Note=PPR 18 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 1176_1210 | 0 | 532.0 | Repeat | Note=PPR 19 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 126_160 | 0 | 532.0 | Repeat | Note=PPR 1 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 1317_1351 | 0 | 532.0 | Repeat | Note=PPR 20 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 161_195 | 0 | 532.0 | Repeat | Note=PPR 2 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 196_230 | 0 | 532.0 | Repeat | Note=PPR 3 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 231_265 | 0 | 532.0 | Repeat | Note=PPR 4 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 266_300 | 0 | 532.0 | Repeat | Note=PPR 5 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 301_335 | 0 | 532.0 | Repeat | Note=PPR 6 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 403_437 | 0 | 532.0 | Repeat | Note=PPR 7 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 438_472 | 0 | 532.0 | Repeat | Note=PPR 8 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 678_709 | 0 | 532.0 | Repeat | Note=PPR 9 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 710_746 | 0 | 532.0 | Repeat | Note=PPR 10 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 747_784 | 0 | 532.0 | Repeat | Note=PPR 11 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 785_820 | 0 | 532.0 | Repeat | Note=PPR 12 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 821_856 | 0 | 532.0 | Repeat | Note=PPR 13 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000409946 | 0 | 14 | 954_988 | 0 | 532.0 | Repeat | Note=PPR 14 |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CRIM1 | chr2:36583766 | chr2:44145537 | ENST00000280527 | + | 1 | 17 | 334_391 | 110.33333333333333 | 1037.0 | Domain | VWFC 1 |
Hgene | CRIM1 | chr2:36583766 | chr2:44145537 | ENST00000280527 | + | 1 | 17 | 401_457 | 110.33333333333333 | 1037.0 | Domain | VWFC 2 |
Hgene | CRIM1 | chr2:36583766 | chr2:44145537 | ENST00000280527 | + | 1 | 17 | 469_498 | 110.33333333333333 | 1037.0 | Domain | Antistasin-like 1 |
Hgene | CRIM1 | chr2:36583766 | chr2:44145537 | ENST00000280527 | + | 1 | 17 | 505_532 | 110.33333333333333 | 1037.0 | Domain | Antistasin-like 2 |
Hgene | CRIM1 | chr2:36583766 | chr2:44145537 | ENST00000280527 | + | 1 | 17 | 539_564 | 110.33333333333333 | 1037.0 | Domain | Antistasin-like 3 |
Hgene | CRIM1 | chr2:36583766 | chr2:44145537 | ENST00000280527 | + | 1 | 17 | 567_592 | 110.33333333333333 | 1037.0 | Domain | Antistasin-like 4 |
Hgene | CRIM1 | chr2:36583766 | chr2:44145537 | ENST00000280527 | + | 1 | 17 | 606_663 | 110.33333333333333 | 1037.0 | Domain | VWFC 3 |
Hgene | CRIM1 | chr2:36583766 | chr2:44145537 | ENST00000280527 | + | 1 | 17 | 677_735 | 110.33333333333333 | 1037.0 | Domain | VWFC 4 |
Hgene | CRIM1 | chr2:36583766 | chr2:44145537 | ENST00000280527 | + | 1 | 17 | 751_809 | 110.33333333333333 | 1037.0 | Domain | VWFC 5 |
Hgene | CRIM1 | chr2:36583766 | chr2:44145537 | ENST00000280527 | + | 1 | 17 | 817_874 | 110.33333333333333 | 1037.0 | Domain | VWFC 6 |
Hgene | CRIM1 | chr2:36583766 | chr2:44145537 | ENST00000280527 | + | 1 | 17 | 314_316 | 110.33333333333333 | 1037.0 | Motif | Cell attachment site |
Hgene | CRIM1 | chr2:36583766 | chr2:44145537 | ENST00000280527 | + | 1 | 17 | 35_939 | 110.33333333333333 | 1037.0 | Topological domain | Extracellular |
Hgene | CRIM1 | chr2:36583766 | chr2:44145537 | ENST00000280527 | + | 1 | 17 | 961_1036 | 110.33333333333333 | 1037.0 | Topological domain | Cytoplasmic |
Hgene | CRIM1 | chr2:36583766 | chr2:44145537 | ENST00000280527 | + | 1 | 17 | 940_960 | 110.33333333333333 | 1037.0 | Transmembrane | Helical |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 126_160 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 1 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 161_195 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 2 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 196_230 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 3 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 231_265 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 4 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 266_300 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 5 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 301_335 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 6 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 403_437 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 7 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 438_472 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 8 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 678_709 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 9 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 710_746 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 10 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 747_784 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 11 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 785_820 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 12 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 821_856 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 13 | |
Tgene | LRPPRC | chr2:36583766 | chr2:44145537 | ENST00000260665 | 26 | 38 | 954_988 | 965.3333333333334 | 1395.0 | Repeat | Note=PPR 14 |
Top |
Fusion Gene Sequence for CRIM1-LRPPRC |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>In-frame_ENST00000280527_ENST00000260665_TCGA-A5-A1OH_CRIM1_chr2_36583766_+_LRPPRC_chr2_44145537_length(transcript)=4079nt_BP=698nt GCCGCCGGCCCGGGCTGGAGCCGAGCGCAGCAGCCACCGCCGCCGCCGCGCCAGAAGTTTGGGTTGAACCGGAGCTGCCGGGAGGAAACT TTTTTCTTTTTTCCCCCTCCCTCCCGGGAGGAGGAGGAGGAGGAGGAGGGGAAGCTGCCGCCGGCGCCAAGGCTCGTGGGCTCGGGGTCG GCGCGGCCCGCAGAAGGGGCGGGGGCCTCGCCCCGCGAGGGGAGGCGCGCCCCGGGGGCCCCGAGAGGGGCGGTGAGGACCGCGGGCTGC TGGTGCGGCGGCGGCGGCGCGTGTGCCCCGCGCAGGGGAGGGCGCCCGCCCCGCTCCCGGCCCGGCTGCGAGGAGGAGGCGGCGGCGGCG CAGGAGGATGTACTTGGTGGCGGGGGACAGGGGGTTGGCCGGCTGCGGGCACCTCCTGGTCTCGCTGCTGGGGCTGCTGCTGCTGCTGGC GCGCTCCGGCACCCGGGCGCTGGTCTGCCTGCCCTGTGACGAGTCCAAGTGCGAGGAGCCCAGGAACTGCCCGGGGAGCATCGTGCAGGG CGTCTGCGGCTGCTGCTACACGTGCGCCAGCCAGAGGAACGAGAGCTGCGGCGGCACCTTCGGGATTTACGGAACCTGCGACCGGGGGCT GCGTTGTGTCATCCGCCCCCCGCTCAATGGCGACTCCCTCACCGAGTACGAAGCGGGCGTTTGCGAAGAAATAAACGGTGACTGGCAAAG AGCTGATGCAGTCTGGAATAAAATCCAAGAAGAAAATGTTATTCCTCGTGAAAAGACATTAAGATTATTAGCAGAAATCCTTAGAGAGGG TAACCAGGAAGTTCCGTTTGACGTACCTGAGTTGTGGTATGAAGATGAAAAACATTCCCTGAATTCTTCGTCAGCCTCAACCACAGAACC TGATTTCCAGAAAGATATATTGATTGCCTGCCGATTGAACCAAAAAAAAGGGGCATATGATATTTTCCTGAATGCAAAAGAGCAAAACAT TGTGTTTAATGCTGAAACCTACAGCAATCTCATTAAATTACTGATGTCAGAAGATTATTTTACACAAGCAATGGAAGTGAAAGCATTCGC GGAGACCCACATCAAGGGCTTCACACTGAACGATGCTGCCAACAGCCGCCTCATCATAACGCAAGTTAGGCGGGATTATTTGAAAGAGGC TGTGACAACACTGAAAACAGTATTGGATCAGCAGCAGACCCCTTCTAGGTTAGCAGTGACCCGTGTCATCCAGGCATTGGCCATGAAGGG TGATGTTGAAAACATAGAAGTAGTTCAGAAGATGTTAAATGGACTCGAAGACTCCATTGGACTTTCAAAAATGGTTTTCATCAATAACAT TGCTTTGGCTCAAATAAAGAATAATAACATAGATGCCGCAATAGAAAACATTGAAAATATGCTTACTTCAGAGAATAAAGTCATTGAACC CCAATACTTCGGCTTGGCATACTTATTCAGAAAAGTAATAGAGGAGCAGTTGGAACCAGCAGTTGAAAAGATAAGCATCATGGCGGAGAG ATTGGCCAATCAGTTTGCAATTTATAAACCTGTCACTGATTTTTTCCTTCAACTTGTGGATGCAGGCAAGGTGGATGATGCCAGAGCTCT CCTACAGAGATGTGGTGCAATTGCTGAACAAACCCCGATTTTGTTGTTGTTCCTCCTTAGGAATTCTAGGAAACAAGGAAAGGCATCAAC TGTGAAATCTGTGTTAGAATTGATTCCTGAATTAAATGAAAAGGAAGAAGCATACAATTCCCTCATGAAAAGCTATGTCTCAGAGAAAGA TGTCACATCTGCTAAAGCACTGTATGAACATTTGACTGCAAAGAATACAAAATTGGATGATCTGTTTCTAAAGCGTTACGCATCTTTGCT GAAGTATGCTGGAGAGCCTGTCCCTTTCATTGAACCCCCTGAAAGCTTTGAATTTTATGCACAGCAGCTAAGAAAATTGAGGGAAAACTC TTCTTGAAATAACCAGGCGATACTTTGTTTTGTATATATTTGTGATTCTGTGTCTACATGTTATTTTGAAGTATATCTGAGGGAAAAATA AATGAAAATTTTCTTTATGTACTTATGTATGTGTGATGCATGTTCAAAGTCTTATTGACCATAACTCTGTGCACTTGGTTATTGGACATT TTTGGAGTTTTTTTCTCTGGGAAAAATCGATAGTGTTTTCTTCAATGCTGCTGCTGTGTGAAGCCATACTTTTTCAGGATTCTTCCCCTA ATTGGCTCTTTGGTTTCCCTGCTCTGTTTCATTTATTTCATTAAAATGTTATTCCTTTATTTAAGATTCACTTATTAGTCTGCTGTTTCT CTGAAAAATTTTAGAGCTAGGTATAGTGACCGTGAACTTTCTAACGCATAATATTCTGTGATACAGCCATTCCGTACATGTGTGAAGTCC TGCATAACTTTCGAACTTTGTTAAATGTTGGCACTAGGAGTCATCAGATCTAGGCTTCATCATTTTCCAGTGAGAAGCAGAGACCCAAAG GGCCTGTTACTTGTGCTTGGTCAGGGGACTGTCTGTCATGCCTGGAGGCTCTTCGGCACACTTCCCCATCTTTCCCTTCTGCCACTGTGG CTTCAAGCACCTCTGTTCATAGAGCGTCTCTGAAATTGAGTCTCGGTCATGACTTATCCCGAAGTAGAGCAATGTGTTTCCTCTCATTGT AGTTTCAGGACTTTGTCAGTACAAGCTCTGCCCTAGGCTTGTTACTTTATACTCATATCCTGAAAAGATGTGATTTCATCTATGAAGGGG TAAAATATTGGTTTGTATTTAATTGTTTGAAATAAAAGTGATCCCTATATTGAATCTCATGCCTGTTAATATCTACACTGTAAGTAGTGA CTTCAAAAAAATTCTAAGATAGGTAGTCAGGAGAGTTTGCCATTATAAAAGGTGTCTTAATAATATGGAATATTGACCTAACTGGAGATG AGGTAATTAATTACCGAAATGTTGAAAATGTTTTGAGAACTCTCCCCATTTTGGGGTATTCCTTGTTCATTTGAATTTGGTGACTCCCTA CTGTTCCAGTTTCAGTGCCAACTTGGGTCACACTGTTCACATCAGGGGAGACCTTGCCTTGGGGACGTAGGCGGGCCTCTTGCAACTTGT GCTGTTGACCTTCTGTCTTGTGGAACTCTCTCTCCTGCATCTGCTACCTGCCCGCAGATGGTGTGAGGGAGGGTTGATGGCGGGAAGCCA GGAAGTAGATGTCATCATGGTATTGGCCAGGCTTTTACTTCAACTCTTTTTGTGGCGTTAGATTTAAGGAAGCAGGGGGCATGGCCAACG TTGAGTCTTGGCCCAGTGGACATAGTGCGGCTTTCCCTTGAGCACTGCCCAGATGCAGGACCTGCACATGTTACAGGTTTGCCAAAAGCA TCTTTTTTTTTTTTTTTTTTTTTGAGATAGTCTTGCTCTGTTGCTTAAGCCAGAGTGCAGTGGCGCAATCTCAGCTCACTGCAACCTCCG CCTCCTGGGTTCAAGTGATTCTTGTGCCTCAGCCTCCCACGTAGCTGAGATTACAGGCTTGCACCACCATGTTCAGCTAATTTTTGTATG GTAAAGACGGAGTTTCACCATGTTGGCCAGGTTGGTCTCGAACTCCTGGCCCCAAGTGATCCTCCCCCTGCGCTCGCTTCAGCCTCCCAA AGTGCTGGGATTACAGGTGTGAGCCACCACGCCTGGCCAAGAGCCTCACTCCTGTCTTTAGTGATTGCACTGAAGCAGGCCTCATTTTTT TGCAGTCATGCTAACCACAAGTTAGTCAACATTCACTAATTGACATTCATTAGAATAGGTCTCCAAGGTGAGGCATAACGTTGGGGTGTA ATCTGGATTTCGCAGTCATCTTTTTGGGGAAACTGAAAGTACCATCTCATTTGCATGAAGTGACTCCACACTGGCCCTGTATATGGACTC TGGTAAAATGTGAGTGTGGTACAGAGGAAATAGGTAAGACCCCCTTATCTAGCCCTCTCGGCAGCAGCGGGGGGGTGTTACAAAGGACTA >In-frame_ENST00000280527_ENST00000260665_TCGA-A5-A1OH_CRIM1_chr2_36583766_+_LRPPRC_chr2_44145537_length(amino acids)=539AA_start in transcript=367_stop in transcript=1986 MYLVAGDRGLAGCGHLLVSLLGLLLLLARSGTRALVCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRC VIRPPLNGDSLTEYEAGVCEEINGDWQRADAVWNKIQEENVIPREKTLRLLAEILREGNQEVPFDVPELWYEDEKHSLNSSSASTTEPDF QKDILIACRLNQKKGAYDIFLNAKEQNIVFNAETYSNLIKLLMSEDYFTQAMEVKAFAETHIKGFTLNDAANSRLIITQVRRDYLKEAVT TLKTVLDQQQTPSRLAVTRVIQALAMKGDVENIEVVQKMLNGLEDSIGLSKMVFINNIALAQIKNNNIDAAIENIENMLTSENKVIEPQY FGLAYLFRKVIEEQLEPAVEKISIMAERLANQFAIYKPVTDFFLQLVDAGKVDDARALLQRCGAIAEQTPILLLFLLRNSRKQGKASTVK -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for CRIM1-LRPPRC |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for CRIM1-LRPPRC |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for CRIM1-LRPPRC |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | CRIM1 | C1865286 | MACROPHTHALMIA, COLOBOMATOUS, WITH MICROCORNEA | 2 | GENOMICS_ENGLAND;ORPHANET |
Tgene | LRPPRC | C0023264 | Leigh Disease | 8 | CLINGEN |
Tgene | LRPPRC | C1838951 | LEIGH SYNDROME DUE TO MITOCHONDRIAL COMPLEX I DEFICIENCY | 8 | CLINGEN |
Tgene | LRPPRC | C1850597 | Leigh Syndrome Due To Mitochondrial Complex II Deficiency | 8 | CLINGEN |
Tgene | LRPPRC | C1850598 | Leigh Syndrome due to Mitochondrial Complex III Deficiency | 8 | CLINGEN |
Tgene | LRPPRC | C1850599 | Leigh Syndrome due to Mitochondrial Complex IV Deficiency | 8 | CLINGEN |
Tgene | LRPPRC | C1850600 | Leigh Syndrome due to Mitochondrial Complex V Deficiency | 8 | CLINGEN |
Tgene | LRPPRC | C2931891 | Necrotizing encephalopathy, infantile subacute, of Leigh | 8 | CLINGEN |
Tgene | LRPPRC | C1857355 | Leigh syndrome , French Canadian type | 4 | CTD_human;GENOMICS_ENGLAND;ORPHANET;UNIPROT |
Tgene | LRPPRC | C0751651 | Mitochondrial Diseases | 1 | GENOMICS_ENGLAND |