|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:E2F3-FARS2 (FusionGDB2 ID:24755) |
Fusion Gene Summary for E2F3-FARS2 |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: E2F3-FARS2 | Fusion gene ID: 24755 | Hgene | Tgene | Gene symbol | E2F3 | FARS2 | Gene ID | 1871 | 10667 |
| Gene name | E2F transcription factor 3 | phenylalanyl-tRNA synthetase 2, mitochondrial | |
| Synonyms | E2F-3 | COXPD14|FARS1|HSPC320|PheRS|SPG77|mtPheRS | |
| Cytomap | 6p22.3 | 6p25.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | transcription factor E2F3 | phenylalanine--tRNA ligase, mitochondrialdJ236A3.1 (phenylalanine-tRNA synthetase)dJ520B18.2 (FARS1 (phenylalanine-tRNA synthetase))mitochondrial PHERSphenylalanine tRNA ligase 2, mitochondrialphenylalanine translasephenylalanine-tRNA synthetase 1 ( | |
| Modification date | 20200322 | 20200313 | |
| UniProtAcc | O00716 | O95363 | |
| Ensembl transtripts involved in fusion gene | ENST00000346618, ENST00000535432, | ENST00000324331, ENST00000274680, | |
| Fusion gene scores | * DoF score | 8 X 3 X 5=120 | 15 X 13 X 10=1950 |
| # samples | 12 | 21 | |
| ** MAII score | log2(12/120*10)=0 | log2(21/1950*10)=-3.21501289097085 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context | PubMed: E2F3 [Title/Abstract] AND FARS2 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | E2F3(20404063)-FARS2(5404774), # samples:2 | ||
| Anticipated loss of major functional domain due to fusion event. | |||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | E2F3 | GO:0000082 | G1/S transition of mitotic cell cycle | 17062573 |
| Hgene | E2F3 | GO:0006606 | protein import into nucleus | 17062573 |
| Hgene | E2F3 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 7739537 |
| Tgene | FARS2 | GO:0006432 | phenylalanyl-tRNA aminoacylation | 10329163 |
| Tgene | FARS2 | GO:0008033 | tRNA processing | 10329163 |
| Fusion gene breakpoints across E2F3 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Fusion gene breakpoints across FARS2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | THCA | TCGA-DJ-A2PU | E2F3 | chr6 | 20404063 | + | FARS2 | chr6 | 5404774 | + |
| ChimerDB4 | THCA | TCGA-DJ-A2PU | E2F3 | chr6 | 20404063 | + | FARS2 | chr6 | 5404774 | + |
Top |
Fusion Gene ORF analysis for E2F3-FARS2 |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| intron-3CDS | ENST00000346618 | ENST00000324331 | E2F3 | chr6 | 20404063 | + | FARS2 | chr6 | 5404774 | + |
| intron-3CDS | ENST00000346618 | ENST00000274680 | E2F3 | chr6 | 20404063 | + | FARS2 | chr6 | 5404774 | + |
| In-frame | ENST00000535432 | ENST00000324331 | E2F3 | chr6 | 20404063 | + | FARS2 | chr6 | 5404774 | + |
| In-frame | ENST00000535432 | ENST00000274680 | E2F3 | chr6 | 20404063 | + | FARS2 | chr6 | 5404774 | + |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000535432 | E2F3 | chr6 | 20404063 | + | ENST00000324331 | FARS2 | chr6 | 5404774 | + | 774 | 30 | 0 | 773 | 257 |
| ENST00000535432 | E2F3 | chr6 | 20404063 | + | ENST00000274680 | FARS2 | chr6 | 5404774 | + | 925 | 30 | 0 | 773 | 257 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000535432 | ENST00000324331 | E2F3 | chr6 | 20404063 | + | FARS2 | chr6 | 5404774 | + | 0.001136052 | 0.99886394 |
| ENST00000535432 | ENST00000274680 | E2F3 | chr6 | 20404063 | + | FARS2 | chr6 | 5404774 | + | 0.001610192 | 0.99838984 |
Top |
Fusion Genomic Features for E2F3-FARS2 |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| E2F3 | chr6 | 20404063 | + | FARS2 | chr6 | 5404774 | + | 1.88E-05 | 0.9999813 |
| E2F3 | chr6 | 20404063 | + | FARS2 | chr6 | 5404774 | + | 1.88E-05 | 0.9999813 |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for E2F3-FARS2 |
| Go to FGviewer for the breakpoints of chr6:20404063-chr6:5404774 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| E2F3 | FARS2 |
| FUNCTION: Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F3 binds specifically to RB1 in a cell-cycle dependent manner. Inhibits adipogenesis, probably through the repression of CEBPA binding to its target gene promoters (By similarity). {ECO:0000250|UniProtKB:O35261}. | FUNCTION: Is responsible for the charging of tRNA(Phe) with phenylalanine in mitochondrial translation. To a lesser extent, also catalyzes direct attachment of m-Tyr (an oxidized version of Phe) to tRNA(Phe), thereby opening the way for delivery of the misacylated tRNA to the ribosome and incorporation of ROS-damaged amino acid into proteins. {ECO:0000269|PubMed:19549855, ECO:0000269|PubMed:22833457}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000274680 | 1 | 7 | 358_450 | 204.0 | 452.0 | Domain | FDX-ACB | |
| Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000324331 | 1 | 7 | 358_450 | 204.0 | 452.0 | Domain | FDX-ACB |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 120_129 | 0 | 466.0 | Compositional bias | Note=Poly-Gly |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 26_31 | 0 | 466.0 | Compositional bias | Note=Poly-Ala |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 45_53 | 0 | 466.0 | Compositional bias | Note=Poly-Ala |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 120_129 | 6.0 | 335.0 | Compositional bias | Note=Poly-Gly |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 26_31 | 6.0 | 335.0 | Compositional bias | Note=Poly-Ala |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 45_53 | 6.0 | 335.0 | Compositional bias | Note=Poly-Ala |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 155_245 | 0 | 466.0 | DNA binding | Ontology_term=ECO:0000255 |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 155_245 | 6.0 | 335.0 | DNA binding | Ontology_term=ECO:0000255 |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 209_245 | 0 | 466.0 | Motif | Note=DEF box |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 209_245 | 6.0 | 335.0 | Motif | Note=DEF box |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 101_153 | 0 | 466.0 | Region | Cyclin A/CDK2 binding |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 204_225 | 0 | 466.0 | Region | Note=Leucine-zipper |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 246_337 | 0 | 466.0 | Region | Dimerization |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 391_465 | 0 | 466.0 | Region | Transactivation |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000346618 | + | 1 | 7 | 432_449 | 0 | 466.0 | Region | Retinoblastoma protein binding |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 101_153 | 6.0 | 335.0 | Region | Cyclin A/CDK2 binding |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 204_225 | 6.0 | 335.0 | Region | Note=Leucine-zipper |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 246_337 | 6.0 | 335.0 | Region | Dimerization |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 391_465 | 6.0 | 335.0 | Region | Transactivation |
| Hgene | E2F3 | chr6:20404063 | chr6:5404774 | ENST00000535432 | + | 1 | 7 | 432_449 | 6.0 | 335.0 | Region | Retinoblastoma protein binding |
| Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000274680 | 1 | 7 | 157_160 | 204.0 | 452.0 | Region | Note=Substrate binding | |
| Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000274680 | 1 | 7 | 186_188 | 204.0 | 452.0 | Region | Note=Substrate binding | |
| Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000274680 | 1 | 7 | 193_195 | 204.0 | 452.0 | Region | Note=Substrate binding | |
| Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000324331 | 1 | 7 | 157_160 | 204.0 | 452.0 | Region | Note=Substrate binding | |
| Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000324331 | 1 | 7 | 186_188 | 204.0 | 452.0 | Region | Note=Substrate binding | |
| Tgene | FARS2 | chr6:20404063 | chr6:5404774 | ENST00000324331 | 1 | 7 | 193_195 | 204.0 | 452.0 | Region | Note=Substrate binding |
Top |
Fusion Gene Sequence for E2F3-FARS2 |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >In-frame_ENST00000535432_ENST00000324331_TCGA-DJ-A2PU_E2F3_chr6_20404063_+_FARS2_chr6_5404774_length(transcript)=774nt_BP=30nt CTGGTTTCGGAAATGCCCTTACAGCAGCAGTTATTTGCTGGTATAAAGGATGGAGAAAGCCTGCAGCTCTTTGAACAAAGTTCTCGCTCT GCGCATAAACAAGAGACACACACCATGGAGGCCGTGAAGCTTGTAGAGTTTGATCTTAAGCAAACGCTTACCAGGCTCATGGCACATCTT TTTGGAGATGAGCTGGAGATAAGATGGGTAGACTGCTACTTCCCTTTTACACATCCTTCCTTTGAGATGGAGATCAACTTTCATGGAGAA TGGCTGGAAGTTCTTGGCTGCGGGGTGATGGAACAACAACTGGTCAATTCAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTA GGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGATATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGT GTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGCAAATATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAG AATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATTGGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACAT CCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTACCGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCAC >In-frame_ENST00000535432_ENST00000324331_TCGA-DJ-A2PU_E2F3_chr6_20404063_+_FARS2_chr6_5404774_length(amino acids)=257AA_start in transcript=0_stop in transcript=773 LVSEMPLQQQLFAGIKDGESLQLFEQSSRSAHKQETHTMEAVKLVEFDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEMEINFHGE WLEVLGCGVMEQQLVNSAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSE -------------------------------------------------------------- >In-frame_ENST00000535432_ENST00000274680_TCGA-DJ-A2PU_E2F3_chr6_20404063_+_FARS2_chr6_5404774_length(transcript)=925nt_BP=30nt CTGGTTTCGGAAATGCCCTTACAGCAGCAGTTATTTGCTGGTATAAAGGATGGAGAAAGCCTGCAGCTCTTTGAACAAAGTTCTCGCTCT GCGCATAAACAAGAGACACACACCATGGAGGCCGTGAAGCTTGTAGAGTTTGATCTTAAGCAAACGCTTACCAGGCTCATGGCACATCTT TTTGGAGATGAGCTGGAGATAAGATGGGTAGACTGCTACTTCCCTTTTACACATCCTTCCTTTGAGATGGAGATCAACTTTCATGGAGAA TGGCTGGAAGTTCTTGGCTGCGGGGTGATGGAACAACAACTGGTCAATTCAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTA GGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGATATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGT GTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGCAAATATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAG AATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATTGGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACAT CCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTACCGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCAC CAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAGGGCAGGTTCTGATGTCACCACTTCACTCAGGCTGCAGCCCTCTTGGGG CTCCAGGATTTGCTGAAAGAGAAAAAGATATGGTTTGTGAACTGGGGCATCAATCATCTTTTGATAAATGGATCAGTTTTAGGACTTTCA >In-frame_ENST00000535432_ENST00000274680_TCGA-DJ-A2PU_E2F3_chr6_20404063_+_FARS2_chr6_5404774_length(amino acids)=257AA_start in transcript=0_stop in transcript=773 LVSEMPLQQQLFAGIKDGESLQLFEQSSRSAHKQETHTMEAVKLVEFDLKQTLTRLMAHLFGDELEIRWVDCYFPFTHPSFEMEINFHGE WLEVLGCGVMEQQLVNSAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSE -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for E2F3-FARS2 |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for E2F3-FARS2 |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
| Tgene | FARS2 | O95363 | DB00120 | Phenylalanine | Small molecule | Approved|Investigational|Nutraceutical | |
| Tgene | FARS2 | O95363 | DB00120 | Phenylalanine | Small molecule | Approved|Investigational|Nutraceutical | |
| Tgene | FARS2 | O95363 | DB00120 | Phenylalanine | Small molecule | Approved|Investigational|Nutraceutical |
Top |
Related Diseases for E2F3-FARS2 |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Hgene | E2F3 | C0007131 | Non-Small Cell Lung Carcinoma | 1 | CTD_human |
| Hgene | E2F3 | C0017668 | Focal glomerulosclerosis | 1 | GENOMICS_ENGLAND |
| Hgene | E2F3 | C3714756 | Intellectual Disability | 1 | GENOMICS_ENGLAND |
| Hgene | E2F3 | C4049702 | Focal Segmental Glomerulosclerosis, Not Otherwise Specified | 1 | GENOMICS_ENGLAND |
| Tgene | FARS2 | C0023264 | Leigh Disease | 7 | CLINGEN |
| Tgene | FARS2 | C1838951 | LEIGH SYNDROME DUE TO MITOCHONDRIAL COMPLEX I DEFICIENCY | 7 | CLINGEN |
| Tgene | FARS2 | C1850597 | Leigh Syndrome Due To Mitochondrial Complex II Deficiency | 7 | CLINGEN |
| Tgene | FARS2 | C1850598 | Leigh Syndrome due to Mitochondrial Complex III Deficiency | 7 | CLINGEN |
| Tgene | FARS2 | C1850599 | Leigh Syndrome due to Mitochondrial Complex IV Deficiency | 7 | CLINGEN |
| Tgene | FARS2 | C1850600 | Leigh Syndrome due to Mitochondrial Complex V Deficiency | 7 | CLINGEN |
| Tgene | FARS2 | C2931891 | Necrotizing encephalopathy, infantile subacute, of Leigh | 7 | CLINGEN |
| Tgene | FARS2 | C3554168 | COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 14 | 4 | CTD_human;GENOMICS_ENGLAND;ORPHANET;UNIPROT |
| Tgene | FARS2 | C4310750 | SPASTIC PARAPLEGIA 77, AUTOSOMAL RECESSIVE | 3 | CTD_human;GENOMICS_ENGLAND;ORPHANET;UNIPROT |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies