|
||||||
|
![]() | Fusion Gene Summary |
![]() | Fusion Gene ORF analysis |
![]() | Fusion Genomic Features |
![]() | Fusion Protein Features |
![]() | Fusion Gene Sequence |
![]() | Fusion Gene PPI analysis |
![]() | Related Drugs |
![]() | Related Diseases |
Fusion gene:EEF2-MAP2K2 (FusionGDB2 ID:25212) |
Fusion Gene Summary for EEF2-MAP2K2 |
Fusion gene summary |
| Fusion gene information | Fusion gene name: EEF2-MAP2K2 | Fusion gene ID: 25212 | Hgene | Tgene | Gene symbol | EEF2 | MAP2K2 | Gene ID | 1938 | 5605 |
| Gene name | eukaryotic translation elongation factor 2 | mitogen-activated protein kinase kinase 2 | |
| Synonyms | EEF-2|EF-2|EF2|SCA26 | CFC4|MAPKK2|MEK2|MKK2|PRKMK2 | |
| Cytomap | 19p13.3 | 19p13.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | elongation factor 2epididymis secretory sperm binding proteinpolypeptidyl-tRNA translocase | dual specificity mitogen-activated protein kinase kinase 2ERK activator kinase 2MAP kinase kinase 2MAPK/ERK kinase 2mitogen-activated protein kinase kinase 2, p45 | |
| Modification date | 20200313 | 20200327 | |
| UniProtAcc | P13639 | P36507 | |
| Ensembl transtripts involved in fusion gene | ENST00000309311, ENST00000600720, | ENST00000262948, ENST00000394867, ENST00000599345, | |
| Fusion gene scores | * DoF score | 44 X 37 X 16=26048 | 6 X 7 X 5=210 |
| # samples | 56 | 9 | |
| ** MAII score | log2(56/26048*10)=-5.53960196732128 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(9/210*10)=-1.22239242133645 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context | PubMed: EEF2 [Title/Abstract] AND MAP2K2 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | EEF2(3985375)-MAP2K2(4090706), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | |||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | MAP2K2 | GO:0036289 | peptidyl-serine autophosphorylation | 8388392 |
| Tgene | MAP2K2 | GO:0071902 | positive regulation of protein serine/threonine kinase activity | 8388392 |
Fusion gene breakpoints across EEF2 (5'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across MAP2K2 (3'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0)* All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | Non-Cancer | 235N | EEF2 | chr19 | 3985375 | - | MAP2K2 | chr19 | 4090706 | - |
Top |
Fusion Gene ORF analysis for EEF2-MAP2K2 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| In-frame | ENST00000309311 | ENST00000262948 | EEF2 | chr19 | 3985375 | - | MAP2K2 | chr19 | 4090706 | - |
| In-frame | ENST00000309311 | ENST00000394867 | EEF2 | chr19 | 3985375 | - | MAP2K2 | chr19 | 4090706 | - |
| 5CDS-intron | ENST00000309311 | ENST00000599345 | EEF2 | chr19 | 3985375 | - | MAP2K2 | chr19 | 4090706 | - |
| intron-3CDS | ENST00000600720 | ENST00000262948 | EEF2 | chr19 | 3985375 | - | MAP2K2 | chr19 | 4090706 | - |
| intron-3CDS | ENST00000600720 | ENST00000394867 | EEF2 | chr19 | 3985375 | - | MAP2K2 | chr19 | 4090706 | - |
| intron-intron | ENST00000600720 | ENST00000599345 | EEF2 | chr19 | 3985375 | - | MAP2K2 | chr19 | 4090706 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000309311 | EEF2 | chr19 | 3985375 | - | ENST00000262948 | MAP2K2 | chr19 | 4090706 | - | 480 | 92 | 352 | 2 | 117 |
| ENST00000309311 | EEF2 | chr19 | 3985375 | - | ENST00000394867 | MAP2K2 | chr19 | 4090706 | - | 468 | 92 | 352 | 2 | 117 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000309311 | ENST00000262948 | EEF2 | chr19 | 3985375 | - | MAP2K2 | chr19 | 4090706 | - | 0.7684453 | 0.23155466 |
| ENST00000309311 | ENST00000394867 | EEF2 | chr19 | 3985375 | - | MAP2K2 | chr19 | 4090706 | - | 0.73927337 | 0.26072663 |
Top |
Fusion Genomic Features for EEF2-MAP2K2 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for EEF2-MAP2K2 |
Go to FGviewer for the breakpoints of chr19:3985375-chr19:4090706 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
![]() |
Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| EEF2 | MAP2K2 |
| FUNCTION: Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome. | FUNCTION: Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in a Thr-Glu-Tyr sequence located in MAP kinases. Activates the ERK1 and ERK2 MAP kinases (By similarity). Activates BRAF in a KSR1 or KSR2-dependent manner; by binding to KSR1 or KSR2 releases the inhibitory intramolecular interaction between KSR1 or KSR2 protein kinase and N-terminal domains which promotes KSR1 or KSR2-BRAF dimerization and BRAF activation (PubMed:29433126). {ECO:0000250|UniProtKB:Q63932, ECO:0000269|PubMed:29433126}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | EEF2 | chr19:3985375 | chr19:4090706 | ENST00000309311 | - | 1 | 15 | 17_362 | 1.0 | 859.0 | Domain | tr-type G |
| Hgene | EEF2 | chr19:3985375 | chr19:4090706 | ENST00000309311 | - | 1 | 15 | 104_108 | 1.0 | 859.0 | Nucleotide binding | GTP |
| Hgene | EEF2 | chr19:3985375 | chr19:4090706 | ENST00000309311 | - | 1 | 15 | 158_161 | 1.0 | 859.0 | Nucleotide binding | GTP |
| Hgene | EEF2 | chr19:3985375 | chr19:4090706 | ENST00000309311 | - | 1 | 15 | 26_33 | 1.0 | 859.0 | Nucleotide binding | GTP |
| Tgene | MAP2K2 | chr19:3985375 | chr19:4090706 | ENST00000262948 | 9 | 11 | 266_315 | 364.0 | 401.0 | Compositional bias | Note=Pro-rich | |
| Tgene | MAP2K2 | chr19:3985375 | chr19:4090706 | ENST00000262948 | 9 | 11 | 72_369 | 364.0 | 401.0 | Domain | Protein kinase | |
| Tgene | MAP2K2 | chr19:3985375 | chr19:4090706 | ENST00000262948 | 9 | 11 | 78_86 | 364.0 | 401.0 | Nucleotide binding | ATP |
Top |
Fusion Gene Sequence for EEF2-MAP2K2 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >In-frame_ENST00000309311_ENST00000262948_235N_EEF2_chr19_3985375_-_MAP2K2_chr19_4090706_length(transcript)=480nt_BP=92nt AGCGTTCTCTTCCGCCGTCGTCGCCGCCATCCTCGGCGCGACTCGCTTCTTTCGGTTCTACCTGGGAGAATCCACCGCCATCCGCCACCA TGAACCACACCTTCATCAAGCGGTCCGAGGTGGAAGAAGTGGATTTTGCCGGCTGGTTGTGTAAAACCCTGCGGCTGAACCAGCCCGGCA CACCCACGCGCACCGCCGTGTGACAGTGGCCGGGCTCCCTGCGTCCCGCTGGTGACCTGCCCACCGTCCCTGTCCATGCCCCGCCCTTCC AGCTGAGGACAGGCTGGCGCCTCCACCCACCCTCCTGCCTCACCCCTGCGGAGAGCACCGTGGCGGGGCGACAGCGCATGCAGGAACGGG GGTCTCCTCTCCTGCCCGTCCTGGCCGGGGTGCCTCTGGGGACGGGCGACGCTGCTGTGTGTGGTCTCAGAGGCTCTGCTTCCTTAGGTT >In-frame_ENST00000309311_ENST00000262948_235N_EEF2_chr19_3985375_-_MAP2K2_chr19_4090706_length(amino acids)=117AA_start in transcript=352_stop in transcript=2 MHALSPRHGALRRGEAGGWVEAPACPQLEGRGMDRDGGQVTSGTQGARPLSHGGARGCAGLVQPQGFTQPAGKIHFFHLGPLDEGVVHGG -------------------------------------------------------------- >In-frame_ENST00000309311_ENST00000394867_235N_EEF2_chr19_3985375_-_MAP2K2_chr19_4090706_length(transcript)=468nt_BP=92nt AGCGTTCTCTTCCGCCGTCGTCGCCGCCATCCTCGGCGCGACTCGCTTCTTTCGGTTCTACCTGGGAGAATCCACCGCCATCCGCCACCA TGAACCACACCTTCATCAAGCGGTCCGAGGTGGAAGAAGTGGATTTTGCCGGCTGGTTGTGTAAAACCCTGCGGCTGAACCAGCCCGGCA CACCCACGCGCACCGCCGTGTGACAGTGGCCGGGCTCCCTGCGTCCCGCTGGTGACCTGCCCACCGTCCCTGTCCATGCCCCGCCCTTCC AGCTGAGGACAGGCTGGCGCCTCCACCCACCCTCCTGCCTCACCCCTGCGGAGAGCACCGTGGCGGGGCGACAGCGCATGCAGGAACGGG GGTCTCCTCTCCTGCCCGTCCTGGCCGGGGTGCCTCTGGGGACGGGCGACGCTGCTGTGTGTGGTCTCAGAGGCTCTGCTTCCTTAGGTT >In-frame_ENST00000309311_ENST00000394867_235N_EEF2_chr19_3985375_-_MAP2K2_chr19_4090706_length(amino acids)=117AA_start in transcript=352_stop in transcript=2 MHALSPRHGALRRGEAGGWVEAPACPQLEGRGMDRDGGQVTSGTQGARPLSHGGARGCAGLVQPQGFTQPAGKIHFFHLGPLDEGVVHGG -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for EEF2-MAP2K2 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for EEF2-MAP2K2 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
| Hgene | EEF2 | P13639 | DB11823 | Esketamine | Inhibitor | Small molecule | Approved|Investigational |
| Hgene | EEF2 | P13639 | DB11823 | Esketamine | Inhibitor | Small molecule | Approved|Investigational |
| Hgene | EEF2 | P13639 | DB12688 | Moxetumomab Pasudotox | Inactivator | Biotech | Approved|Investigational |
| Hgene | EEF2 | P13639 | DB12688 | Moxetumomab Pasudotox | Inactivator | Biotech | Approved|Investigational |
| Tgene | MAP2K2 | P36507 | DB06616 | Bosutinib | Inhibitor | Small molecule | Approved |
| Tgene | MAP2K2 | P36507 | DB06616 | Bosutinib | Inhibitor | Small molecule | Approved |
| Tgene | MAP2K2 | P36507 | DB06616 | Bosutinib | Inhibitor | Small molecule | Approved |
| Tgene | MAP2K2 | P36507 | DB06616 | Bosutinib | Inhibitor | Small molecule | Approved |
| Tgene | MAP2K2 | P36507 | DB08911 | Trametinib | Antagonist|Inhibitor | Small molecule | Approved |
| Tgene | MAP2K2 | P36507 | DB08911 | Trametinib | Antagonist|Inhibitor | Small molecule | Approved |
| Tgene | MAP2K2 | P36507 | DB08911 | Trametinib | Antagonist|Inhibitor | Small molecule | Approved |
| Tgene | MAP2K2 | P36507 | DB08911 | Trametinib | Antagonist|Inhibitor | Small molecule | Approved |
| Tgene | MAP2K2 | P36507 | DB11689 | Selumetinib | Inhibitor | Small molecule | Approved|Investigational |
| Tgene | MAP2K2 | P36507 | DB11689 | Selumetinib | Inhibitor | Small molecule | Approved|Investigational |
| Tgene | MAP2K2 | P36507 | DB11689 | Selumetinib | Inhibitor | Small molecule | Approved|Investigational |
| Tgene | MAP2K2 | P36507 | DB11689 | Selumetinib | Inhibitor | Small molecule | Approved|Investigational |
| Tgene | MAP2K2 | P36507 | DB11967 | Binimetinib | Inhibitor | Small molecule | Approved|Investigational |
| Tgene | MAP2K2 | P36507 | DB11967 | Binimetinib | Inhibitor | Small molecule | Approved|Investigational |
| Tgene | MAP2K2 | P36507 | DB11967 | Binimetinib | Inhibitor | Small molecule | Approved|Investigational |
| Tgene | MAP2K2 | P36507 | DB11967 | Binimetinib | Inhibitor | Small molecule | Approved|Investigational |
| Tgene | MAP2K2 | P36507 | DB12010 | Fostamatinib | Inhibitor | Small molecule | Approved|Investigational |
| Tgene | MAP2K2 | P36507 | DB12010 | Fostamatinib | Inhibitor | Small molecule | Approved|Investigational |
| Tgene | MAP2K2 | P36507 | DB12010 | Fostamatinib | Inhibitor | Small molecule | Approved|Investigational |
| Tgene | MAP2K2 | P36507 | DB12010 | Fostamatinib | Inhibitor | Small molecule | Approved|Investigational |
Top |
Related Diseases for EEF2-MAP2K2 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Hgene | EEF2 | C0001418 | Adenocarcinoma | 1 | CTD_human |
| Hgene | EEF2 | C0006142 | Malignant neoplasm of breast | 1 | CTD_human |
| Hgene | EEF2 | C0007134 | Renal Cell Carcinoma | 1 | CTD_human |
| Hgene | EEF2 | C0024121 | Lung Neoplasms | 1 | CTD_human |
| Hgene | EEF2 | C0027626 | Neoplasm Invasiveness | 1 | CTD_human |
| Hgene | EEF2 | C0027627 | Neoplasm Metastasis | 1 | CTD_human |
| Hgene | EEF2 | C0029408 | Degenerative polyarthritis | 1 | CTD_human |
| Hgene | EEF2 | C0086743 | Osteoarthrosis Deformans | 1 | CTD_human |
| Hgene | EEF2 | C0205641 | Adenocarcinoma, Basal Cell | 1 | CTD_human |
| Hgene | EEF2 | C0205642 | Adenocarcinoma, Oxyphilic | 1 | CTD_human |
| Hgene | EEF2 | C0205643 | Carcinoma, Cribriform | 1 | CTD_human |
| Hgene | EEF2 | C0205644 | Carcinoma, Granular Cell | 1 | CTD_human |
| Hgene | EEF2 | C0205645 | Adenocarcinoma, Tubular | 1 | CTD_human |
| Hgene | EEF2 | C0242379 | Malignant neoplasm of lung | 1 | CTD_human |
| Hgene | EEF2 | C0279702 | Conventional (Clear Cell) Renal Cell Carcinoma | 1 | CTD_human |
| Hgene | EEF2 | C0678222 | Breast Carcinoma | 1 | CTD_human |
| Hgene | EEF2 | C1257931 | Mammary Neoplasms, Human | 1 | CTD_human |
| Hgene | EEF2 | C1266042 | Chromophobe Renal Cell Carcinoma | 1 | CTD_human |
| Hgene | EEF2 | C1266043 | Sarcomatoid Renal Cell Carcinoma | 1 | CTD_human |
| Hgene | EEF2 | C1266044 | Collecting Duct Carcinoma of the Kidney | 1 | CTD_human |
| Hgene | EEF2 | C1306837 | Papillary Renal Cell Carcinoma | 1 | CTD_human |
| Hgene | EEF2 | C1458155 | Mammary Neoplasms | 1 | CTD_human |
| Hgene | EEF2 | C1836395 | SPINOCEREBELLAR ATAXIA 26 | 1 | CTD_human;ORPHANET;UNIPROT |
| Hgene | EEF2 | C4704874 | Mammary Carcinoma, Human | 1 | CTD_human |
| Tgene | MAP2K2 | C1275081 | Cardio-facio-cutaneous syndrome | 13 | CLINGEN;CTD_human;GENOMICS_ENGLAND;ORPHANET |
| Tgene | MAP2K2 | C3809007 | CARDIOFACIOCUTANEOUS SYNDROME 4 | 7 | GENOMICS_ENGLAND;UNIPROT |
| Tgene | MAP2K2 | C0028326 | Noonan Syndrome | 4 | CLINGEN;CTD_human |
| Tgene | MAP2K2 | C0010606 | Adenoid Cystic Carcinoma | 1 | CTD_human |
| Tgene | MAP2K2 | C0025202 | melanoma | 1 | CGI;CTD_human |
| Tgene | MAP2K2 | C0041409 | Turner Syndrome, Male | 1 | CTD_human |
| Tgene | MAP2K2 | C0553586 | Cafe-au-lait macules with pulmonary stenosis | 1 | ORPHANET |
| Tgene | MAP2K2 | C0587248 | Costello syndrome (disorder) | 1 | CLINGEN;CTD_human |
| Tgene | MAP2K2 | C1527404 | Female Pseudo-Turner Syndrome | 1 | CTD_human |
| Tgene | MAP2K2 | C2931482 | Neurofibromatosis-Noonan syndrome | 1 | ORPHANET |
| Tgene | MAP2K2 | C4551602 | Noonan Syndrome 1 | 1 | CTD_human |