|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:EZR-ANP32B (FusionGDB2 ID:28028) |
Fusion Gene Summary for EZR-ANP32B |
Fusion gene summary |
Fusion gene information | Fusion gene name: EZR-ANP32B | Fusion gene ID: 28028 | Hgene | Tgene | Gene symbol | EZR | ANP32B | Gene ID | 7430 | 10541 |
Gene name | ezrin | acidic nuclear phosphoprotein 32 family member B | |
Synonyms | CVIL|CVL|HEL-S-105|VIL2 | APRIL|PHAPI2|SSP29 | |
Cytomap | 6q25.3 | 9q22.33 | |
Type of gene | protein-coding | protein-coding | |
Description | ezrincytovillin 2epididymis secretory protein Li 105p81villin 2 (ezrin) | acidic leucine-rich nuclear phosphoprotein 32 family member Bacidic (leucine-rich) nuclear phosphoprotein 32 family, member Bacidic protein rich in leucinesputative HLA-DR-associated protein I-2silver-stainable protein SSP29 | |
Modification date | 20200322 | 20200313 | |
UniProtAcc | P15311 | Q92688 | |
Ensembl transtripts involved in fusion gene | ENST00000337147, ENST00000367075, ENST00000392177, ENST00000476189, | ENST00000339399, ENST00000473205, | |
Fusion gene scores | * DoF score | 26 X 22 X 10=5720 | 19 X 20 X 7=2660 |
# samples | 32 | 21 | |
** MAII score | log2(32/5720*10)=-4.15987133677839 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(21/2660*10)=-3.66296501272243 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: EZR [Title/Abstract] AND ANP32B [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | EZR(159204556)-ANP32B(100773628), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | EZR-ANP32B seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. EZR-ANP32B seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. EZR-ANP32B seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. EZR-ANP32B seems lost the major protein functional domain in Tgene partner, which is a epigenetic factor due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | EZR | GO:0048015 | phosphatidylinositol-mediated signaling | 25591774 |
Hgene | EZR | GO:0051017 | actin filament bundle assembly | 10793131 |
Tgene | ANP32B | GO:0006334 | nucleosome assembly | 20538007 |
Tgene | ANP32B | GO:0045596 | negative regulation of cell differentiation | 22705300 |
Fusion gene breakpoints across EZR (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across ANP32B (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChiTaRS5.0 | N/A | BF817728 | EZR | chr6 | 159204556 | - | ANP32B | chr9 | 100773628 | + |
Top |
Fusion Gene ORF analysis for EZR-ANP32B |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
Frame-shift | ENST00000337147 | ENST00000339399 | EZR | chr6 | 159204556 | - | ANP32B | chr9 | 100773628 | + |
5CDS-intron | ENST00000337147 | ENST00000473205 | EZR | chr6 | 159204556 | - | ANP32B | chr9 | 100773628 | + |
In-frame | ENST00000367075 | ENST00000339399 | EZR | chr6 | 159204556 | - | ANP32B | chr9 | 100773628 | + |
5CDS-intron | ENST00000367075 | ENST00000473205 | EZR | chr6 | 159204556 | - | ANP32B | chr9 | 100773628 | + |
Frame-shift | ENST00000392177 | ENST00000339399 | EZR | chr6 | 159204556 | - | ANP32B | chr9 | 100773628 | + |
5CDS-intron | ENST00000392177 | ENST00000473205 | EZR | chr6 | 159204556 | - | ANP32B | chr9 | 100773628 | + |
intron-3CDS | ENST00000476189 | ENST00000339399 | EZR | chr6 | 159204556 | - | ANP32B | chr9 | 100773628 | + |
intron-intron | ENST00000476189 | ENST00000473205 | EZR | chr6 | 159204556 | - | ANP32B | chr9 | 100773628 | + |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000367075 | EZR | chr6 | 159204556 | - | ENST00000339399 | ANP32B | chr9 | 100773628 | + | 1542 | 867 | 97 | 1029 | 310 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000367075 | ENST00000339399 | EZR | chr6 | 159204556 | - | ANP32B | chr9 | 100773628 | + | 0.000407124 | 0.99959284 |
Top |
Fusion Genomic Features for EZR-ANP32B |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for EZR-ANP32B |
Go to FGviewer for the breakpoints of chr6:159204556-chr9:100773628 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
EZR | ANP32B |
FUNCTION: Probably involved in connections of major cytoskeletal structures to the plasma membrane. In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with PLEKHG6, required for normal macropinocytosis. {ECO:0000269|PubMed:17881735, ECO:0000269|PubMed:18270268, ECO:0000269|PubMed:19111582}. | FUNCTION: Multifunctional protein that is involved in the regulation of many processes including cell proliferation, apoptosis, cell cycle progression or transcription (PubMed:20015864, PubMed:18039846). Regulates the proliferation of neuronal stem cells, differentiation of leukemic cells and progression from G1 to S phase of the cell cycle. As negative regulator of caspase-3-dependent apoptosis, may act as an antagonist of ANP32A in regulating tissue homeostasis (PubMed:20015864). Exhibits histone chaperone properties, able to recruit histones to certain promoters, thus regulating the transcription of specific genes (PubMed:20538007, PubMed:18039846). Plays also an essential role in the nucleocytoplasmic transport of specific mRNAs via the uncommon nuclear mRNA export receptor XPO1/CRM1 (PubMed:17178712). Participates in the regulation of adequate adaptive immune responses by acting on mRNA expression and cell proliferation (By similarity). {ECO:0000250|UniProtKB:Q9EST5, ECO:0000269|PubMed:17178712, ECO:0000269|PubMed:18039846, ECO:0000269|PubMed:20015864, ECO:0000269|PubMed:20538007}.; FUNCTION: (Microbial infection) Plays an essential role in influenza A and B viral genome replication (PubMed:33045004, PubMed:31217244). Plays also a role in foamy virus mRNA export from the nucleus to the cytoplasm (PubMed:21159877). {ECO:0000269|PubMed:21159877, ECO:0000269|PubMed:31217244, ECO:0000269|PubMed:33045004}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | EZR | chr6:159204556 | chr9:100773628 | ENST00000337147 | - | 6 | 13 | 115_120 | 232.66666666666666 | 587.0 | Motif | [IL]-x-C-x-x-[DE] motif |
Hgene | EZR | chr6:159204556 | chr9:100773628 | ENST00000367075 | - | 7 | 14 | 115_120 | 232.66666666666666 | 587.0 | Motif | [IL]-x-C-x-x-[DE] motif |
Tgene | ANP32B | chr6:159204556 | chr9:100773628 | ENST00000339399 | 0 | 7 | 146_251 | 0 | 252.0 | Compositional bias | Note=Asp/Glu-rich (highly acidic) | |
Tgene | ANP32B | chr6:159204556 | chr9:100773628 | ENST00000339399 | 0 | 7 | 123_161 | 0 | 252.0 | Domain | Note=LRRCT | |
Tgene | ANP32B | chr6:159204556 | chr9:100773628 | ENST00000339399 | 0 | 7 | 239_242 | 0 | 252.0 | Motif | Nuclear localization signal | |
Tgene | ANP32B | chr6:159204556 | chr9:100773628 | ENST00000339399 | 0 | 7 | 16_40 | 0 | 252.0 | Repeat | LRR 1 | |
Tgene | ANP32B | chr6:159204556 | chr9:100773628 | ENST00000339399 | 0 | 7 | 43_64 | 0 | 252.0 | Repeat | LRR 2 | |
Tgene | ANP32B | chr6:159204556 | chr9:100773628 | ENST00000339399 | 0 | 7 | 65_84 | 0 | 252.0 | Repeat | LRR 3 | |
Tgene | ANP32B | chr6:159204556 | chr9:100773628 | ENST00000339399 | 0 | 7 | 89_110 | 0 | 252.0 | Repeat | LRR 4 |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | EZR | chr6:159204556 | chr9:100773628 | ENST00000337147 | - | 6 | 13 | 2_295 | 232.66666666666666 | 587.0 | Domain | FERM |
Hgene | EZR | chr6:159204556 | chr9:100773628 | ENST00000367075 | - | 7 | 14 | 2_295 | 232.66666666666666 | 587.0 | Domain | FERM |
Top |
Fusion Gene Sequence for EZR-ANP32B |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>In-frame_ENST00000367075_ENST00000339399_BF817728_EZR_chr6_159204556_-_ANP32B_chr9_100773628_length(transcript)=1542nt_BP=867nt GGACCCGCCCCGCCGGGGCTTTTGGGAGCGCGGGCAGCGAGCGCACTCGGCGGACGCAAGGGCGGCGGGGAGCACACGGAGCACTGCAGG CGCCGGGTTGGGACAGCGTCTTCGCTGCTGCTGGATAGTCGTGTTTTCGGGGATCGAGGATACTCACCAGAAACCGAAAATGCCGAAACC AATCAATGTCCGAGTTACCACCATGGATGCAGAGCTGGAGTTTGCAATCCAGCCAAATACAACTGGAAAACAGCTTTTTGATCAGGTGGT AAAGACTATCGGCCTCCGGGAAGTGTGGTACTTTGGCCTCCACTATGTGGATAATAAAGGATTTCCTACCTGGCTGAAGCTGGATAAGAA GGTGTCTGCCCAGGAGGTCAGGAAGGAGAATCCCCTCCAGTTCAAGTTCCGGGCCAAGTTCTACCCTGAAGATGTGGCTGAGGAGCTCAT CCAGGACATCACCCAGAAACTTTTCTTCCTCCAAGTGAAGGAAGGAATCCTTAGCGATGAGATCTACTGCCCCCCTGAGACTGCCGTGCT CTTGGGGTCCTACGCTGTGCAGGCCAAGTTTGGGGACTACAACAAAGAAGTGCACAAGTCTGGGTACCTCAGCTCTGAGCGGCTGATCCC TCAAAGAGTGATGGACCAGCACAAACTTACCAGGGACCAGTGGGAGGACCGGATCCAGGTGTGGCATGCGGAACACCGTGGGATGCTCAA AGATAATGCTATGTTGGAATACCTGAAGATTGCTCAGGACCTGGAAATGTATGGAATCAACTATTTCGAGATAAAAAACAAGAAAGGAAC AGACCTTTGGCTTGGAGTTGATGCCCTTGGACTGAATATTTATGAGAAAGATGATAAAGATGTAGAAGGGGATGAGGACGACGATGAAGT CAGTGAGGAGGAAGAAGAATTTGGACTTGATGAAGAAGATGAAGATGAGGATGAGGATGAAGAGGAGGAAGAAGGTGGGAAAGGTGAAAA GAGGAAGAGAGAAACAGATGATGAAGGAGAAGATGATTAAGACCCCAGATGACCTGCAGAAACAGAACTGTTCAGTATTGGTTGGACTGC TCATGGATTTTGTAGCTGTTTAAAAAAAAAAAAAAGGTAGCTGTGATACAAACCCCAGGACACCCACCCACCCAAAGAGCCAAAGAATAG TTCCTGTGACATTCCGCCTTCCTTCCATGTAGTCCCTCTTGGTAATCTACCACCAAGCTTGTGGACTTCACCCCAACAAAATTGTAAGCG TTGTTAGGTTTTTGTGTAAGATTCTTGCTGTAGCGTGGATAGCTGTGATTGGTGAGTCAACCGTCTGTGGCTACCAGTTACACTGAGATT GTAACAGCATTTTTACTTTCTGTACAACAAAAAAGCTTTGTAAATAAAATCTTAACATTTTGGGTCTGTTTTTTCATGCTTTGCTTTTTA ATTATTATTATTATTTTTTTTACATTAGGACATTTTATGTGACAACTGCCAAAAAAGTATTTTTAAGAATTTAAGCGAAATAAACAGTTA >In-frame_ENST00000367075_ENST00000339399_BF817728_EZR_chr6_159204556_-_ANP32B_chr9_100773628_length(amino acids)=310AA_start in transcript=97_stop in transcript=1029 MGQRLRCCWIVVFSGIEDTHQKPKMPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVS AQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQR VMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKDVEGDEDDDEVSE -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for EZR-ANP32B |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Hgene | EZR | chr6:159204556 | chr9:100773628 | ENST00000337147 | - | 6 | 13 | 244_586 | 232.66666666666666 | 587.0 | SCYL3 |
Hgene | EZR | chr6:159204556 | chr9:100773628 | ENST00000367075 | - | 7 | 14 | 244_586 | 232.66666666666666 | 587.0 | SCYL3 |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for EZR-ANP32B |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for EZR-ANP32B |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | EZR | C0033578 | Prostatic Neoplasms | 3 | CTD_human |
Hgene | EZR | C0376358 | Malignant neoplasm of prostate | 3 | CTD_human |
Hgene | EZR | C0007097 | Carcinoma | 1 | CTD_human |
Hgene | EZR | C0023893 | Liver Cirrhosis, Experimental | 1 | CTD_human |
Hgene | EZR | C0024667 | Animal Mammary Neoplasms | 1 | CTD_human |
Hgene | EZR | C0024668 | Mammary Neoplasms, Experimental | 1 | CTD_human |
Hgene | EZR | C0027627 | Neoplasm Metastasis | 1 | CTD_human |
Hgene | EZR | C0029408 | Degenerative polyarthritis | 1 | CTD_human |
Hgene | EZR | C0086743 | Osteoarthrosis Deformans | 1 | CTD_human |
Hgene | EZR | C0205696 | Anaplastic carcinoma | 1 | CTD_human |
Hgene | EZR | C0205697 | Carcinoma, Spindle-Cell | 1 | CTD_human |
Hgene | EZR | C0205698 | Undifferentiated carcinoma | 1 | CTD_human |
Hgene | EZR | C0205699 | Carcinomatosis | 1 | CTD_human |
Hgene | EZR | C1257925 | Mammary Carcinoma, Animal | 1 | CTD_human |