|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:FOXK2-SKAP1 (FusionGDB2 ID:31018) |
Fusion Gene Summary for FOXK2-SKAP1 |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: FOXK2-SKAP1 | Fusion gene ID: 31018 | Hgene | Tgene | Gene symbol | FOXK2 | SKAP1 | Gene ID | 3607 | 8631 |
| Gene name | forkhead box K2 | src kinase associated phosphoprotein 1 | |
| Synonyms | ILF|ILF-1|ILF1|nGTBP | HEL-S-81p|SCAP1|SKAP55 | |
| Cytomap | 17q25.3 | 17q21.32 | |
| Type of gene | protein-coding | protein-coding | |
| Description | forkhead box protein K2FOXK1G/T-mismatch specific binding proteincellular transcription factor ILF-1interleukin enhancer-binding factor 1 | src kinase-associated phosphoprotein 1SKAP-55epididymis secretory sperm binding protein Li 81ppp55src family-associated phosphoprotein 1src kinase-associated phosphoprotein of 55 kDa | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q01167 | . | |
| Ensembl transtripts involved in fusion gene | ENST00000335255, ENST00000529652, | ENST00000336915, ENST00000584924, | |
| Fusion gene scores | * DoF score | 31 X 14 X 13=5642 | 24 X 12 X 10=2880 |
| # samples | 34 | 29 | |
| ** MAII score | log2(34/5642*10)=-4.05260001444787 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(29/2880*10)=-3.31194400631474 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context | PubMed: FOXK2 [Title/Abstract] AND SKAP1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | FOXK2(80545148)-SKAP1(46474147), # samples:3 | ||
| Anticipated loss of major functional domain due to fusion event. | FOXK2-SKAP1 seems lost the major protein functional domain in Hgene partner, which is a transcription factor due to the frame-shifted ORF. FOXK2-SKAP1 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. FOXK2-SKAP1 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | FOXK2 | GO:0045892 | negative regulation of transcription, DNA-templated | 20810654|25451922 |
| Hgene | FOXK2 | GO:0045893 | positive regulation of transcription, DNA-templated | 22083952 |
| Hgene | FOXK2 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 9065434 |
| Tgene | SKAP1 | GO:0002821 | positive regulation of adaptive immune response | 12652296 |
| Tgene | SKAP1 | GO:0033625 | positive regulation of integrin activation | 12652296 |
| Tgene | SKAP1 | GO:0034116 | positive regulation of heterotypic cell-cell adhesion | 12652296 |
| Tgene | SKAP1 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 11909961 |
| Tgene | SKAP1 | GO:1903039 | positive regulation of leukocyte cell-cell adhesion | 12652296 |
| Fusion gene breakpoints across FOXK2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Fusion gene breakpoints across SKAP1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BRCA | TCGA-AO-A0JG-01A | FOXK2 | chr17 | 80545148 | + | SKAP1 | chr17 | 46474147 | - |
| ChimerDB4 | BRCA | TCGA-AO-A0JG | FOXK2 | chr17 | 80545148 | + | SKAP1 | chr17 | 46474147 | - |
| ChimerDB4 | BRCA | TCGA-AO-A0JG-01A | FOXK2 | chr17 | 80545148 | - | SKAP1 | chr17 | 46474147 | - |
Top |
Fusion Gene ORF analysis for FOXK2-SKAP1 |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| Frame-shift | ENST00000335255 | ENST00000336915 | FOXK2 | chr17 | 80545148 | + | SKAP1 | chr17 | 46474147 | - |
| In-frame | ENST00000335255 | ENST00000584924 | FOXK2 | chr17 | 80545148 | + | SKAP1 | chr17 | 46474147 | - |
| intron-3CDS | ENST00000529652 | ENST00000336915 | FOXK2 | chr17 | 80545148 | + | SKAP1 | chr17 | 46474147 | - |
| intron-3CDS | ENST00000529652 | ENST00000584924 | FOXK2 | chr17 | 80545148 | + | SKAP1 | chr17 | 46474147 | - |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000335255 | FOXK2 | chr17 | 80545148 | + | ENST00000584924 | SKAP1 | chr17 | 46474147 | - | 3292 | 1960 | 111 | 2993 | 960 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000335255 | ENST00000584924 | FOXK2 | chr17 | 80545148 | + | SKAP1 | chr17 | 46474147 | - | 0.001649551 | 0.9983505 |
Top |
Fusion Genomic Features for FOXK2-SKAP1 |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for FOXK2-SKAP1 |
| Go to FGviewer for the breakpoints of chr17:80545148-chr17:46474147 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| FOXK2 | . |
| FUNCTION: Transcriptional regulator involved in different processes such as glucose metabolism, aerobic glycolysis and autophagy (By similarity). Recognizes and binds the forkhead DNA sequence motif (5'-GTAAACA-3') and can both act as a transcription activator or repressor, depending on the context (PubMed:22083952, PubMed:25451922). Together with FOXK1, acts as a key regulator of metabolic reprogramming towards aerobic glycolysis, a process in which glucose is converted to lactate in the presence of oxygen (By similarity). Acts by promoting expression of enzymes for glycolysis (such as hexokinase-2 (HK2), phosphofructokinase, pyruvate kinase (PKLR) and lactate dehydrogenase), while suppressing further oxidation of pyruvate in the mitochondria by up-regulating pyruvate dehydrogenase kinases PDK1 and PDK4 (By similarity). Probably plays a role in gluconeogenesis during overnight fasting, when lactate from white adipose tissue and muscle is the main substrate (By similarity). Together with FOXK1, acts as a negative regulator of autophagy in skeletal muscle: in response to starvation, enters the nucleus, binds the promoters of autophagy genes and represses their expression, preventing proteolysis of skeletal muscle proteins (By similarity). In addition to the 5'-GTAAACA-3' DNA motif, also binds the 5'-TGANTCA-3' palindromic DNA motif, and co-associates with JUN/AP-1 to activate transcription (PubMed:22083952). Also able to bind to a minimal DNA heteroduplex containing a G/T-mismatch with 5'-TRT[G/T]NB-3' sequence (PubMed:20097901). Binds to NFAT-like motifs (purine-rich) in the IL2 promoter (PubMed:1339390). Positively regulates WNT/beta-catenin signaling by translocating DVL proteins into the nucleus (PubMed:25805136). Also binds to HIV-1 long terminal repeat. May be involved in both positive and negative regulation of important viral and cellular promoter elements (PubMed:1909027). {ECO:0000250|UniProtKB:Q3UCQ1, ECO:0000269|PubMed:1339390, ECO:0000269|PubMed:1909027, ECO:0000269|PubMed:20097901, ECO:0000269|PubMed:22083952, ECO:0000269|PubMed:25451922, ECO:0000269|PubMed:25805136}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | FOXK2 | chr17:80545148 | chr17:46474147 | ENST00000335255 | + | 8 | 9 | 10_93 | 595.3333333333334 | 661.0 | Compositional bias | Note=Gly-rich |
| Hgene | FOXK2 | chr17:80545148 | chr17:46474147 | ENST00000335255 | + | 8 | 9 | 258_353 | 595.3333333333334 | 661.0 | DNA binding | Fork-head |
| Hgene | FOXK2 | chr17:80545148 | chr17:46474147 | ENST00000335255 | + | 8 | 9 | 54_128 | 595.3333333333334 | 661.0 | Domain | FHA |
| Hgene | FOXK2 | chr17:80545148 | chr17:46474147 | ENST00000335255 | + | 8 | 9 | 300_318 | 595.3333333333334 | 661.0 | Region | DNA-binding%3B major groove |
| Hgene | FOXK2 | chr17:80545148 | chr17:46474147 | ENST00000335255 | + | 8 | 9 | 328_332 | 595.3333333333334 | 661.0 | Region | DNA-binding%3B minor groove |
| Hgene | FOXK2 | chr17:80545148 | chr17:46474147 | ENST00000335255 | + | 8 | 9 | 348_353 | 595.3333333333334 | 661.0 | Region | DNA-binding%3B minor groove |
| Tgene | SKAP1 | chr17:80545148 | chr17:46474147 | ENST00000336915 | 0 | 13 | 220_230 | 15.333333333333334 | 448.0 | Compositional bias | Note=Poly-Glu | |
| Tgene | SKAP1 | chr17:80545148 | chr17:46474147 | ENST00000584924 | 0 | 12 | 220_230 | 15.333333333333334 | 360.0 | Compositional bias | Note=Poly-Glu | |
| Tgene | SKAP1 | chr17:80545148 | chr17:46474147 | ENST00000336915 | 0 | 13 | 107_210 | 15.333333333333334 | 448.0 | Domain | PH | |
| Tgene | SKAP1 | chr17:80545148 | chr17:46474147 | ENST00000336915 | 0 | 13 | 294_355 | 15.333333333333334 | 448.0 | Domain | SH3 | |
| Tgene | SKAP1 | chr17:80545148 | chr17:46474147 | ENST00000584924 | 0 | 12 | 107_210 | 15.333333333333334 | 360.0 | Domain | PH | |
| Tgene | SKAP1 | chr17:80545148 | chr17:46474147 | ENST00000584924 | 0 | 12 | 294_355 | 15.333333333333334 | 360.0 | Domain | SH3 |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Top |
Fusion Gene Sequence for FOXK2-SKAP1 |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >In-frame_ENST00000335255_ENST00000584924_TCGA-AO-A0JG-01A_FOXK2_chr17_80545148_+_SKAP1_chr17_46474147_length(transcript)=3292nt_BP=1960nt CGGCCGCGCGTGCTCCCGCCCCTCGCCGCCGCTCGCTCGCTCGCCGGCCGGCGGCCTCCGCTCGGCCCCCTCCCTCAGCTCCGGTGCGCG GCGGCCGACGACCCGCGCGGCCTGGGCCTCGGCCCGCGCCACCGGCGCCCGCGCGGAGCGGCCCGGGGGCCCTCACGCAGGCCCATGGCG GCGGCCGCGGCGGCGCTCTCGGGCGCGGGCACGCCACCCGCGGGCGGCGGGGCCGGGGGCGGCGGGGCCGGGGGCGGCGGGTCCCCGCCG GGCGGCTGGGCCGTGGCGCGCCTGGAGGGCCGCGAGTTCGAGTATCTGATGAAGAAGCGCTCGGTGACCATCGGCCGCAACTCGTCGCAG GGCTCGGTGGACGTGAGCATGGGCCACTCGAGCTTCATCTCCCGGCGCCACCTCGAGATCTTCACGCCCCCGGGCGGCGGCGGCCATGGC GGGGCCGCTCCGGAGCTGCCGCCCGCGCAGCCCAGGCCCGACGCCGGCGGCGACTTCTACCTGCGCTGCTTGGGCAAGAACGGGGTATTC GTGGACGGCGTGTTCCAGAGGCGCGGGGCGCCGCCGCTGCAGCTGCCGCGCGTGTGCACATTCAGGTTCCCGAGCACAAACATCAAGATA ACGTTCACTGCCCTGTCCAGCGAGAAGAGAGAGAAGCAGGAGGCGTCTGAGTCTCCAGTGAAGGCCGTACAGCCACACATCTCGCCCCTG ACCATCAACATTCCAGACACCATGGCCCACCTCATCAGCCCTCTGCCCTCCCCCACGGGAACCATCAGCGCTGCAAACTCCTGCCCCTCC AGCCCCCGGGGAGCGGGGTCTTCAGGGTACAAGGTGGGCCGAGTGATGCCATCTGACCTCAATTTAATGGCTGACAACTCACAGCCTGAA AATGAAAAGGAAGCTTCAGGTGGAGACAGCCCGAAGGATGATTCAAAGCCGCCTTACTCCTACGCGCAGCTGATAGTTCAGGCGATTACG ATGGCTCCCGACAAACAGCTCACCCTGAACGGGATTTATACACACATCACTAAAAATTATCCCTACTACAGGACTGCGGACAAGGGCTGG CAGAATTCAATTCGCCACAATCTCTCTCTGAATCGTTATTTCATCAAAGTGCCGCGTTCCCAGGAAGAACCAGGCAAAGGCTCGTTCTGG AGGATAGACCCAGCCTCTGAAAGCAAATTAATAGAACAGGCTTTTAGGAAACGACGGCCTAGGGGCGTGCCCTGCTTTAGAACCCCTCTG GGACCGCTCTCTTCTAGGAGTGCCCCAGCCTCTCCCAATCACGCGGGAGTGCTGTCTGCTCACTCTAGTGGCGCCCAGACCCCTGAGAGC CTGTCGAGGGAAGGTTCGCCGGCCCCCCTGGAGCCTGAGCCTGGCGCTGCACAGCCCAAACTCGCTGTCATCCAGGAAGCCCGGTTTGCC CAGAGCGCCCCAGGGTCACCTCTGTCCAGTCAGCCAGTCTTAATCACCGTCCAGCGGCAGCTACCACAGGCCATCAAGCCTGTCACCTAC ACTGTGGCCACCCCAGTGACCACCTCGACCTCCCAGCCACCCGTCGTGCAGACGGTTCACGTCGTCCACCAGATCCCAGCGGTGTCGGTC ACCAGTGTGGCCGGACTGGCCCCAGCGAACACGTACACTGTCTCTGGACAAGCTGTGGTCACCCCGGCAGCCGTGCTGGCCCCTCCTAAG GCAGAGGCCCAGGAGAATGGAGACCACAGGGAAGTCAAAGTGAAAGTAGAGCCTATTCCCGCCATTGGCCACGCCACGCTCGGCACTGCC AGCCGGATCATTCAGACGGCACAGACCACCCCGGTCCAGACGGTGACCATAGTACAACAGGCACCTCTAGGTCAACACCAGCTACCAATA AAAACTGTAACACAAAACGGCACTCACGTGGCATCAGTCCCCACTGCGGTCCACGGCCAGGTGAACAATGATGCTGAAGAGTTTCTGGCA GAAGGTTTGCGGAATGAGAACCTCAGCGCTGTTGCAAGGGATCACAGAGACCATATTCTACGGGGCTTTCAGCAAATCAAAGCCAGGTAC TATTGGGATTTTCAGCCCCAAGGGGGAGACATTGGACAGGACAGCTCTGATGATAATCACAGCGGGACTCTTGGCCTGTCCCTCACATCC GATGCACCCTTTTTGTCAGATTATCAGGATGAGGGAATGGAAGACATCGTAAAAGGAGCTCAAGAACTTGATAACGTAATCAAGCAAGGA TACTTGGAGAAGAAAAGCAAAGATCATAGTTTCTTTGGATCGGAGTGGCAGAAGCGATGGTGTGTTGTCAGCAGAGGTCTCTTCTACTAC TATGCTAATGAGAAGAGCAAGCAGCCCAAAGGGACCTTCCTCATTAAGGGCTACGGTGTACGGATGGCCCCCCACCTGCGAAGAGATTCC AAGAAAGAATCCTGCTTTGAACTGACCTCCCAGGATAGGCGCAGCTATGAGTTTACAGCTACTAGTCCAGCAGAAGCCAGAGACTGGGTG GATCAAATAAGTTTCTTGTTAAAGGATCTGAGCTCCTTAACCATTCCATATGAAGAGGATGAGGAGGAAGAAGAAAAAGAAGAGACATAT GATGATATTGATGGTTTTGACTCCCCAAGTTGTGGTTCCCAGTGCAGACCCACTATCTTGCCTGGGAGTGTGGGGATAAAAGAGCCTACA GAGGAGAAAGAAGAAGAAGATATTTATGAAGTCTTGCCAGATGAAGAGCATGATCTAGAAGAGGATGAGAGTGGCACTCGACGAAAAGGA GTAGACTATGCCAGTTACTACCAGGGCCTATGGGATTGCCATGGTGACCAGCCAGATGAACTGTCCTTCCAACGGGGTGACCTCATCCGT ATTCTGAGCAAGGAGTATAACATGTATGGCTGGTGGGTGGGAGAACTGAACAGCCTCGTTGGGATTGTTCCAAAGGAGTATCTCACCACT GCCTTTGAAGTGGAAGAAAGATGAAACCCAGGTATCAGAACCATGGCCAATGAACTGCCTAATAGTTGAGTGGAACTTGTGGGCCACTAC TTTGTTTCTCTGAAAGATGAGAGTTGCCAGTGAAGTAGCTTTTCTTCATTTCTCATACTAATGCTAGTGATTCACCACTGATGGAAAGAA AATGCCTCTGGAATTGTTTTTTTCTTAAATTTGGGGACAGTGTCACTTAGGATAAGGTTCAACTAATAGCAACATAAAATCTAAACTAAA >In-frame_ENST00000335255_ENST00000584924_TCGA-AO-A0JG-01A_FOXK2_chr17_80545148_+_SKAP1_chr17_46474147_length(amino acids)=960AA_start in transcript=111_stop in transcript=2993 MGLGPRHRRPRGAARGPSRRPMAAAAAALSGAGTPPAGGGAGGGGAGGGGSPPGGWAVARLEGREFEYLMKKRSVTIGRNSSQGSVDVSM GHSSFISRRHLEIFTPPGGGGHGGAAPELPPAQPRPDAGGDFYLRCLGKNGVFVDGVFQRRGAPPLQLPRVCTFRFPSTNIKITFTALSS EKREKQEASESPVKAVQPHISPLTINIPDTMAHLISPLPSPTGTISAANSCPSSPRGAGSSGYKVGRVMPSDLNLMADNSQPENEKEASG GDSPKDDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASE SKLIEQAFRKRRPRGVPCFRTPLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLEPEPGAAQPKLAVIQEARFAQSAPGSP LSSQPVLITVQRQLPQAIKPVTYTVATPVTTSTSQPPVVQTVHVVHQIPAVSVTSVAGLAPANTYTVSGQAVVTPAAVLAPPKAEAQENG DHREVKVKVEPIPAIGHATLGTASRIIQTAQTTPVQTVTIVQQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQVNNDAEEFLAEGLRNEN LSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSK DHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLL KDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYY -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for FOXK2-SKAP1 |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| Tgene | SKAP1 | chr17:80545148 | chr17:46474147 | ENST00000336915 | 0 | 13 | 290_295 | 15.333333333333334 | 448.0 | FYB1 | |
| Tgene | SKAP1 | chr17:80545148 | chr17:46474147 | ENST00000584924 | 0 | 12 | 290_295 | 15.333333333333334 | 360.0 | FYB1 |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for FOXK2-SKAP1 |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for FOXK2-SKAP1 |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Tgene | SKAP1 | C0919267 | ovarian neoplasm | 1 | CTD_human |
| Tgene | SKAP1 | C1140680 | Malignant neoplasm of ovary | 1 | CTD_human |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies