|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:GNG5-NMI (FusionGDB2 ID:33640) |
Fusion Gene Summary for GNG5-NMI |
Fusion gene summary |
Fusion gene information | Fusion gene name: GNG5-NMI | Fusion gene ID: 33640 | Hgene | Tgene | Gene symbol | GNG5 | NMI | Gene ID | 2787 | 9111 |
Gene name | G protein subunit gamma 5 | N-myc and STAT interactor | |
Synonyms | - | - | |
Cytomap | 1p22.3 | 2q23.3 | |
Type of gene | protein-coding | protein-coding | |
Description | guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5guanine nucleotide binding protein (G protein), gamma 5 | N-myc-interactor | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | P63218 | Q13287 | |
Ensembl transtripts involved in fusion gene | ENST00000487806, ENST00000370645, ENST00000370641, | ENST00000243346, | |
Fusion gene scores | * DoF score | 5 X 4 X 4=80 | 6 X 4 X 5=120 |
# samples | 5 | 6 | |
** MAII score | log2(5/80*10)=-0.678071905112638 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(6/120*10)=-1 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: GNG5 [Title/Abstract] AND NMI [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | GNG5(84971693)-NMI(152127389), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Fusion gene breakpoints across GNG5 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across NMI (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | COAD | TCGA-DM-A1HB | GNG5 | chr1 | 84971693 | - | NMI | chr2 | 152127389 | - |
Top |
Fusion Gene ORF analysis for GNG5-NMI |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
intron-3CDS | ENST00000487806 | ENST00000243346 | GNG5 | chr1 | 84971693 | - | NMI | chr2 | 152127389 | - |
In-frame | ENST00000370645 | ENST00000243346 | GNG5 | chr1 | 84971693 | - | NMI | chr2 | 152127389 | - |
In-frame | ENST00000370641 | ENST00000243346 | GNG5 | chr1 | 84971693 | - | NMI | chr2 | 152127389 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000370645 | GNG5 | chr1 | 84971693 | - | ENST00000243346 | NMI | chr2 | 152127389 | - | 832 | 421 | 265 | 603 | 112 |
ENST00000370641 | GNG5 | chr1 | 84971693 | - | ENST00000243346 | NMI | chr2 | 152127389 | - | 966 | 555 | 521 | 153 | 122 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000370645 | ENST00000243346 | GNG5 | chr1 | 84971693 | - | NMI | chr2 | 152127389 | - | 0.17565706 | 0.82434297 |
ENST00000370641 | ENST00000243346 | GNG5 | chr1 | 84971693 | - | NMI | chr2 | 152127389 | - | 0.28023258 | 0.71976745 |
Top |
Fusion Genomic Features for GNG5-NMI |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for GNG5-NMI |
Go to FGviewer for the breakpoints of chr1:84971693-chr2:152127389 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
GNG5 | NMI |
FUNCTION: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. | FUNCTION: Acts as a signaling pathway regulator involved in innate immune system response (PubMed:9989503, PubMed:26342464, PubMed:29038465, PubMed:29350881). In response to interleukin 2/IL2 and interferon IFN-gamma/IFNG, interacts with signal transducer and activator of transcription/STAT which activate the transcription of downstream genes involved in a multitude of signals for development and homeostasis (PubMed:9989503). Enhances the recruitment of CBP/p300 coactivators to STAT1 and STAT5, resulting in increased STAT1- and STAT5-dependent transcription (PubMed:9989503). In response to interferon IFN-alpha, associates in a complex with signaling pathway regulator IFI35 to regulate immune response; the complex formation prevents proteasome-mediated degradation of IFI35 (PubMed:10779520, PubMed:10950963). In complex with IFI35, inhibits virus-triggered type I IFN-beta production when ubiquitinated by ubiquitin-protein ligase TRIM21 (PubMed:26342464). In complex with IFI35, negatively regulates nuclear factor NF-kappa-B signaling by inhibiting the nuclear translocation, activation and transcription of NF-kappa-B subunit p65/RELA, resulting in the inhibition of endothelial cell proliferation, migration and re-endothelialization of injured arteries (PubMed:29350881). Negatively regulates virus-triggered type I interferon/IFN production by inducing proteosome-dependent degradation of IRF7, a transcriptional regulator of type I IFN, thereby interfering with cellular antiviral responses (By similarity). Beside its role as an intracellular signaling pathway regulator, also functions extracellularly as damage-associated molecular patterns (DAMPs) to promote inflammation, when actively released by macrophage to the extracellular space during cell injury or pathogen invasion (PubMed:29038465). Macrophage-secreted NMI activates NF-kappa-B signaling in adjacent macrophages through Toll-like receptor 4/TLR4 binding and activation, thereby inducing NF-kappa-B translocation from the cytoplasm into the nucleus which promotes the release of proinflammatory cytokines (PubMed:29038465). {ECO:0000250|UniProtKB:O35309, ECO:0000269|PubMed:10779520, ECO:0000269|PubMed:10950963, ECO:0000269|PubMed:26342464, ECO:0000269|PubMed:29038465, ECO:0000269|PubMed:29350881, ECO:0000269|PubMed:9989503}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | NMI | chr1:84971693 | chr2:152127389 | ENST00000243346 | 6 | 8 | 30_64 | 247.0 | 308.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | NMI | chr1:84971693 | chr2:152127389 | ENST00000243346 | 6 | 8 | 103_192 | 247.0 | 308.0 | Domain | NID 1 | |
Tgene | NMI | chr1:84971693 | chr2:152127389 | ENST00000243346 | 6 | 8 | 201_292 | 247.0 | 308.0 | Domain | NID 2 |
Top |
Fusion Gene Sequence for GNG5-NMI |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>In-frame_ENST00000370645_ENST00000243346_TCGA-DM-A1HB_GNG5_chr1_84971693_-_NMI_chr2_152127389_length(transcript)=832nt_BP=421nt CTTCCCACAAACTGGGAGGAAAACTGAGACCTCCTGGTCACCCGCCGCCGGGCCTTTTAGAAACTCCCACAAGCTCTGCCTTCCCTCCCT GGTCCTCTTCAGACCCCCTCTTAGTTCTTCGCGGCTAACGGCTCGCGCTCGGGGCCGGGTGTGGAGCTGGAACAGAGGGCTGGCAAGGCG CGCATGCGCACCGAGGGTGGAGCCGCTGAGCACAGAACCGGAAACTTAGAGACAAAGTTCGGAGCCCCGCCCCCGCCGCGCGCCGCTGAG TTGTCTGGCCCCGCCGACCCACGGCCCACGACCCACCGACCCACGAATCGGCCCGGCCGTCGCGTGCACCATGTCTGGCTCCTCCAGCGT CGCCGCTATGAAGAAAGTGGTTCAACAGCTCCGGCTGGAGGCCGGACTCAACCGCGTAAAAATATTTTCAGGAACATCTAAGAGGACAGT GCTTCTGACAGGAATGGAAGGCATTCAAATGGATGAAGAAATTGTGGAGGATTTAATTAACATTCACTTTCAACGGGCAAAGAATGGAGG TGGAGAAGTAGATGTGGTCAAGTGTTCTCTAGGTCAACCTCACATAGCATACTTTGAAGAATAGACTTAACAGAATCATGAAAACTATAG CTTTTTAACCCGGATTACTGTAAATGTTTGACAAAAATGAATATGCTTTTCCTTAAAAAATGAAAACTTTAATTTTTACCATCCATTTAT GTTTAGATACAAAACTTATTTCCATGTTTCTGAATCTTCTTTGTTTCAAATGGTGCTGCATGTTTTCAACTACAATAAGTGCACTGTAAT >In-frame_ENST00000370645_ENST00000243346_TCGA-DM-A1HB_GNG5_chr1_84971693_-_NMI_chr2_152127389_length(amino acids)=112AA_start in transcript=265_stop in transcript=603 MSCLAPPTHGPRPTDPRIGPAVACTMSGSSSVAAMKKVVQQLRLEAGLNRVKIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKN -------------------------------------------------------------- >In-frame_ENST00000370641_ENST00000243346_TCGA-DM-A1HB_GNG5_chr1_84971693_-_NMI_chr2_152127389_length(transcript)=966nt_BP=555nt CTTCCCACAAACTGGGAGGAAAACTGAGACCTCCTGGTCACCCGCCGCCGGGCCTTTTAGAAACTCCCACAAGCTCTGCCTTCCCTCCCT GGTCCTCTTCAGACCCCCTCTTAGTTCTTCGCGGCTAACGGTAAGCTCTCTCCTTACCTCTCCCTAATCGGCCCCTCTGGAGAGGAAAAG AAAACTTAAGAGTCGGGTCGCGCTAGCCTCCAGCAGCCGCCGCGCCCACCGACTGCTCCGCCCCTTCTCCTCCCCCTCCTCCAGGCTCGC GCTCGGGGCCGGGTGTGGAGCTGGAACAGAGGGCTGGCAAGGCGCGCATGCGCACCGAGGGTGGAGCCGCTGAGCACAGAACCGGAAACT TAGAGACAAAGTTCGGAGCCCCGCCCCCGCCGCGCGCCGCTGAGTTGTCTGGCCCCGCCGACCCACGGCCCACGACCCACCGACCCACGA ATCGGCCCGGCCGTCGCGTGCACCATGTCTGGCTCCTCCAGCGTCGCCGCTATGAAGAAAGTGGTTCAACAGCTCCGGCTGGAGGCCGGA CTCAACCGCGTAAAAATATTTTCAGGAACATCTAAGAGGACAGTGCTTCTGACAGGAATGGAAGGCATTCAAATGGATGAAGAAATTGTG GAGGATTTAATTAACATTCACTTTCAACGGGCAAAGAATGGAGGTGGAGAAGTAGATGTGGTCAAGTGTTCTCTAGGTCAACCTCACATA GCATACTTTGAAGAATAGACTTAACAGAATCATGAAAACTATAGCTTTTTAACCCGGATTACTGTAAATGTTTGACAAAAATGAATATGC TTTTCCTTAAAAAATGAAAACTTTAATTTTTACCATCCATTTATGTTTAGATACAAAACTTATTTCCATGTTTCTGAATCTTCTTTGTTT >In-frame_ENST00000370641_ENST00000243346_TCGA-DM-A1HB_GNG5_chr1_84971693_-_NMI_chr2_152127389_length(amino acids)=122AA_start in transcript=521_stop in transcript=153 MLNHFLHSGDAGGARHGARDGRADSWVGGSWAVGRRGQTTQRRAAGAGLRTLSLSFRFCAQRLHPRCACAPCQPSVPAPHPAPSASLEEG -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for GNG5-NMI |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for GNG5-NMI |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for GNG5-NMI |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | GNG5 | C0033578 | Prostatic Neoplasms | 1 | CTD_human |
Hgene | GNG5 | C0376358 | Malignant neoplasm of prostate | 1 | CTD_human |
Tgene | NMI | C0023893 | Liver Cirrhosis, Experimental | 1 | CTD_human |