|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:IPO7-CTR9 (FusionGDB2 ID:39888) |
Fusion Gene Summary for IPO7-CTR9 |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: IPO7-CTR9 | Fusion gene ID: 39888 | Hgene | Tgene | Gene symbol | IPO7 | CTR9 | Gene ID | 10527 | 9646 |
| Gene name | importin 7 | CTR9 homolog, Paf1/RNA polymerase II complex component | |
| Synonyms | Imp7|RANBP7 | SH2BP1|TSBP|p150|p150TSP | |
| Cytomap | 11p15.4 | 11p15.4 | |
| Type of gene | protein-coding | protein-coding | |
| Description | importin-7RAN-binding protein 7 | RNA polymerase-associated protein CTR9 homologCtr9, Paf1/RNA polymerase II complex component, homologSH2 domain binding protein 1 (tetratricopeptide repeat containing)TPR-containing, SH2-binding phosphoprotein | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | O95373 | Q6PD62 | |
| Ensembl transtripts involved in fusion gene | ENST00000379719, ENST00000533680, | ENST00000361367, | |
| Fusion gene scores | * DoF score | 14 X 10 X 11=1540 | 6 X 6 X 4=144 |
| # samples | 17 | 6 | |
| ** MAII score | log2(17/1540*10)=-3.17932369944456 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(6/144*10)=-1.26303440583379 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context | PubMed: IPO7 [Title/Abstract] AND CTR9 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | IPO7(9406394)-CTR9(10774219), # samples:3 | ||
| Anticipated loss of major functional domain due to fusion event. | |||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | CTR9 | GO:0010390 | histone monoubiquitination | 16307923 |
| Tgene | CTR9 | GO:0019827 | stem cell population maintenance | 19345177 |
| Tgene | CTR9 | GO:0032968 | positive regulation of transcription elongation from RNA polymerase II promoter | 20178742 |
| Tgene | CTR9 | GO:0033523 | histone H2B ubiquitination | 16307923 |
| Tgene | CTR9 | GO:0045638 | negative regulation of myeloid cell differentiation | 20541477 |
| Tgene | CTR9 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 20178742 |
| Fusion gene breakpoints across IPO7 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Fusion gene breakpoints across CTR9 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | SKCM | TCGA-WE-A8K5-06A | IPO7 | chr11 | 9406394 | + | CTR9 | chr11 | 10774219 | + |
| ChimerDB4 | SKCM | TCGA-WE-A8K5-06A | IPO7 | chr11 | 9406394 | + | CTR9 | chr11 | 10774219 | + |
| ChimerDB4 | SKCM | TCGA-WE-A8K5-06A | IPO7 | chr11 | 9406394 | - | CTR9 | chr11 | 10774219 | + |
Top |
Fusion Gene ORF analysis for IPO7-CTR9 |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| In-frame | ENST00000379719 | ENST00000361367 | IPO7 | chr11 | 9406394 | + | CTR9 | chr11 | 10774219 | + |
| intron-3CDS | ENST00000533680 | ENST00000361367 | IPO7 | chr11 | 9406394 | + | CTR9 | chr11 | 10774219 | + |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000379719 | IPO7 | chr11 | 9406394 | + | ENST00000361367 | CTR9 | chr11 | 10774219 | + | 4341 | 226 | 142 | 3702 | 1186 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000379719 | ENST00000361367 | IPO7 | chr11 | 9406394 | + | CTR9 | chr11 | 10774219 | + | 0.000827332 | 0.9991726 |
Top |
Fusion Genomic Features for IPO7-CTR9 |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| IPO7 | chr11 | 9406394 | + | CTR9 | chr11 | 10774218 | + | 1.40E-08 | 1 |
| IPO7 | chr11 | 9406394 | + | CTR9 | chr11 | 10774218 | + | 1.40E-08 | 1 |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for IPO7-CTR9 |
| Go to FGviewer for the breakpoints of chr11:9406394-chr11:10774219 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| IPO7 | CTR9 |
| FUNCTION: Functions in nuclear protein import, either by acting as autonomous nuclear transport receptor or as an adapter-like protein in association with the importin-beta subunit KPNB1. Acting autonomously, is thought to serve itself as receptor for nuclear localization signals (NLS) and to promote translocation of import substrates through the nuclear pore complex (NPC) by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates autonomously the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In association with KPNB1 mediates the nuclear import of H1 histone and the Ran-binding site of IPO7 is not required but synergizes with that of KPNB1 in importin/substrate complex dissociation. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones. {ECO:0000269|PubMed:10228156, ECO:0000269|PubMed:9687515}.; FUNCTION: (Microbial infection) Mediates the nuclear import of HIV-1 reverse transcription complex (RTC) integrase. Binds and mediates the nuclear import of HIV-1 Rev. {ECO:0000269|PubMed:12853482, ECO:0000269|PubMed:16704975}. | FUNCTION: Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. PAF1C associates with RNA polymerase II through interaction with POLR2A CTD non-phosphorylated and 'Ser-2'- and 'Ser-5'-phosphorylated forms and is involved in transcriptional elongation, acting both independently and synergistically with TCEA1 and in cooperation with the DSIF complex and HTATSF1. PAF1C is required for transcription of Hox and Wnt target genes. PAF1C is involved in hematopoiesis and stimulates transcriptional activity of KMT2A/MLL1; it promotes leukemogenesis through association with KMT2A/MLL1-rearranged oncoproteins, such as KMT2A/MLL1-MLLT3/AF9 and KMT2A/MLL1-MLLT1/ENL. PAF1C is involved in histone modifications such as ubiquitination of histone H2B and methylation on histone H3 'Lys-4' (H3K4me3). PAF1C recruits the RNF20/40 E3 ubiquitin-protein ligase complex and the E2 enzyme UBE2A or UBE2B to chromatin which mediate monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1); UB2A/B-mediated H2B ubiquitination is proposed to be coupled to transcription. PAF1C is involved in mRNA 3' end formation probably through association with cleavage and poly(A) factors. In case of infection by influenza A strain H3N2, PAF1C associates with viral NS1 protein, thereby regulating gene transcription. Required for mono- and trimethylation on histone H3 'Lys-4' (H3K4me3) and dimethylation on histone H3 'Lys-79' (H3K4me3). Required for Hox gene transcription. Required for the trimethylation of histone H3 'Lys-4' (H3K4me3) on genes involved in stem cell pluripotency; this function is synergistic with CXXC1 indicative for an involvement of the SET1 complex. Involved in transcriptional regulation of IL6-responsive genes and in JAK-STAT pathway; may regulate DNA-association of STAT3 (By similarity). {ECO:0000250|UniProtKB:Q62018, ECO:0000269|PubMed:16024656, ECO:0000269|PubMed:16307923, ECO:0000269|PubMed:19345177, ECO:0000269|PubMed:19952111, ECO:0000269|PubMed:20178742, ECO:0000269|PubMed:20541477, ECO:0000269|PubMed:21329879}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 1015_1172 | 15.0 | 1174.0 | Compositional bias | Note=Ser-rich | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 844_1011 | 15.0 | 1174.0 | Compositional bias | Note=Lys-rich | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 904_908 | 15.0 | 1174.0 | Compositional bias | Note=Poly-Gly | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 933_936 | 15.0 | 1174.0 | Compositional bias | Note=Poly-Lys | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 956_959 | 15.0 | 1174.0 | Compositional bias | Note=Poly-Lys | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 129_162 | 15.0 | 1174.0 | Repeat | Note=TPR 2 | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 163_196 | 15.0 | 1174.0 | Repeat | Note=TPR 3 | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 198_231 | 15.0 | 1174.0 | Repeat | Note=TPR 4 | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 235_268 | 15.0 | 1174.0 | Repeat | Note=TPR 5 | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 306_339 | 15.0 | 1174.0 | Repeat | Note=TPR 6 | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 341_374 | 15.0 | 1174.0 | Repeat | Note=TPR 7 | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 412_444 | 15.0 | 1174.0 | Repeat | Note=TPR 8 | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 41_75 | 15.0 | 1174.0 | Repeat | Note=TPR 1 | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 451_484 | 15.0 | 1174.0 | Repeat | Note=TPR 9 | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 497_530 | 15.0 | 1174.0 | Repeat | Note=TPR 10 | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 531_564 | 15.0 | 1174.0 | Repeat | Note=TPR 11 | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 566_598 | 15.0 | 1174.0 | Repeat | Note=TPR 12 | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 613_646 | 15.0 | 1174.0 | Repeat | Note=TPR 13 | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 647_680 | 15.0 | 1174.0 | Repeat | Note=TPR 14 | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 681_714 | 15.0 | 1174.0 | Repeat | Note=TPR 15 | |
| Tgene | CTR9 | chr11:9406394 | chr11:10774219 | ENST00000361367 | 0 | 25 | 717_750 | 15.0 | 1174.0 | Repeat | Note=TPR 16 |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | IPO7 | chr11:9406394 | chr11:10774219 | ENST00000379719 | + | 1 | 25 | 885_957 | 28.0 | 1039.0 | Compositional bias | Note=Asp-rich |
| Hgene | IPO7 | chr11:9406394 | chr11:10774219 | ENST00000379719 | + | 1 | 25 | 22_101 | 28.0 | 1039.0 | Domain | Importin N-terminal |
Top |
Fusion Gene Sequence for IPO7-CTR9 |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >In-frame_ENST00000379719_ENST00000361367_TCGA-WE-A8K5-06A_IPO7_chr11_9406394_+_CTR9_chr11_10774219_length(transcript)=4341nt_BP=226nt GTTCTATCCGGGGCCTTGGCGCTTCTCTTTCCTTTCGCGCCGGTTGCCGCTGCGGAGCGCGGCGGGTCCATGTGCGCAGTGAGTGGCGCT ATTCCTGGCCCAGTAGCACCCGAGCCCCGGGTTTGACCGAGTCCGCGCTGCGATGGACCCCAACACCATTATCGAGGCCCTGCGGGGCAC TATGGACCCAGCCCTGCGTGAGGCCGCGGAGCGCCAGCTCAATGAAGTCATTGAACTTGACTTCGATCAGTTACCGGAGGGAGATGAAGT TATCAGTATTCTGAAACAGGAACACACACAACTGCACATATGGATTGCTTTGGCGCTGGAATACTACAAGCAAGGAAAAACAGAAGAGTT TGTAAAATTGTTGGAAGCAGCACGTATAGATGGCAATTTGGACTATAGAGACCATGAAAAAGACCAGATGACTTGCTTGGATACATTGGC AGCGTATTATGTACAACAGGCTCGGAAAGAAAAGAATAAGGACAATAAAAAGGATCTTATTACACAGGCCACCTTGTTGTATACAATGGC CGATAAAATTATTATGTATGATCAGAACCATTTGTTGGGAAGAGCCTGCTTCTGCCTACTTGAGGGTGACAAAATGGATCAAGCTGATGC ACAGTTTCATTTTGTACTCAATCAGTCTCCAAATAATATTCCAGCCCTTCTTGGTAAAGCTTGCATTTCCTTCAACAAGAAGGATTACAG AGGAGCTCTTGCTTACTATAAGAAAGCATTGCGTACTAACCCAGGATGTCCAGCGGAAGTTCGTTTAGGAATGGGTCATTGCTTTGTGAA ACTTAACAAACTGGAAAAAGCTCGTCTGGCATTCAGCAGAGCCCTGGAACTCAATTCCAAATGCGTGGGAGCATTGGTTGGACTGGCTGT TCTAGAACTCAACAATAAAGAGGCTGATTCCATTAAAAATGGTGTCCAGCTTCTTTCCAGAGCCTATACTATTGATCCTAGCAACCCTAT GGTATTGAACCATTTGGCAAATCACTTTTTCTTCAAAAAGGATTATAGTAAAGTCCAGCATCTGGCCCTCCATGCATTCCATAATACAGA AGTGGAAGCTATGCAAGCAGAGAGCTGCTATCAGCTAGCTAGATCATTCCATGTTCAGGAAGATTATGACCAAGCTTTTCAGTACTATTA TCAAGCCACACAGTTTGCCTCATCCTCTTTTGTGCTCCCATTTTTTGGTTTGGGACAAATGTATATTTATCGAGGTGACAAAGAAAATGC ATCTCAGTGCTTTGAGAAGGTTTTGAAAGCTTATCCTAATAATTACGAAACTATGAAAATTCTCGGCTCTCTCTATGCTGCCTCAGAAGA TCAAGAAAAACGAGATATTGCCAAGGGCCATTTGAAGAAGGTCACAGAACAGTATCCCGATGATGTTGAAGCTTGGATTGAATTGGCACA AATCTTAGAACAGACTGATATACAGGGTGCCCTTTCAGCCTATGGAACAGCAACACGAATCCTTCAGGAGAAAGTGCAGGCCGATGTTCC TCCAGAGATTCTCAATAATGTGGGTGCCCTCCATTTTAGACTTGGAAACCTAGGGGAGGCTAAGAAATATTTTTTGGCGTCATTGGACCG TGCAAAAGCAGAAGCGGAACACGATGAGCATTACTATAACGCCATTTCCGTTACCACGTCATATAATCTCGCCAGGCTATATGAGGCGAT GTGTGAATTCCATGAAGCAGAAAAACTGTATAAAAACATCTTACGCGAACATCCTAATTATGTTGACTGCTATTTGCGCCTAGGAGCCAT GGCTAGAGATAAGGGAAACTTTTATGAGGCTTCAGATTGGTTTAAGGAAGCTCTTCAGATTAATCAGGATCATCCAGATGCTTGGTCTTT GATTGGCAATCTTCATTTGGCAAAACAAGAATGGGGTCCTGGGCAGAAGAAGTTTGAGAGGATATTAAAACAGCCATCCACACAGAGTGA TACCTATTCTATGCTAGCCCTTGGCAACGTGTGGCTCCAAACTTTACATCAGCCCACCCGAGATCGAGAAAAGGAAAAGCGTCATCAAGA TCGTGCTCTGGCCATCTACAAACAAGTACTCAGAAATGATGCAAAGAATCTGTATGCTGCCAATGGCATAGGAGCTGTTTTGGCCCACAA AGGATATTTTCGTGAAGCTCGTGATGTATTTGCCCAAGTAAGAGAAGCAACAGCAGATATTAGTGATGTGTGGCTGAACTTAGCACACAT CTATGTGGAGCAAAAGCAGTACATCAGCGCCGTTCAGATGTATGAAAACTGCCTCCGAAAGTTCTATAAGCACCAAAACACTGAAGTTGT ACTCTATTTGGCCCGGGCCCTCTTCAAGTGTGGCAAGTTACAGGAATGCAAACAGACTTTGCTGAAGGCTAGACATGTGGCACCCAGTGA TACAGTTCTTATGTTTAATGTGGCCTTGGTCCTGCAAAGATTAGCTACCTCTGTCCTGAAAGATGAAAAAAGTAATCTGAAGGAAGTACT TAATGCTGTGAAAGAACTGGAGCTTGCACATAGATACTTCAGTTATTTGAGTAAAGTGGGAGATAAAATGAGATTTGATTTGGCCCTTGC TGCTACAGAAGCCAGGCAGTGTTCTGACTTACTGAGCCAGGCCCAGTACCATGTGGCCCGGGCACGCAAACAAGATGAAGAAGAGCGGGA GCTGCGGGCCAAGCAAGAGCAAGAAAAGGAGCTGTTAAGGCAGAAACTTCTTAAAGAACAGGAAGAGAAACGTCTCAGAGAAAAGGAAGA GCAAAAGAAACTTTTGGAACAGCGGGCCCAGTATGTGGAGAAGACCAAAAATATTCTTATGTTTACTGGTGAGACTGAAGCAACAAAAGA GAAGAAAAGAGGTGGTGGTGGTGGACGGCGTTCTAAGAAGGGAGGAGAGTTTGATGAATTTGTCAATGATGACACTGATGATGACCTACC TATATCCAAAAAGAAGAAGAGAAGAAAGGGTAGTGGCAGTGAACAAGAAGGTGAAGATGAGGAGGGTGGTGAGAGAAAGAAGAAAAAGAG GAGAAGACATCCAAAGGGAGAAGAAGGATCTGATGATGATGAAACAGAAAATGGCCCCAAACCAAAAAAACGACGTCCACCAAAAGCAGA GAAGAAAAAGGCTCCCAAGCCAGAACGTCTGCCTCCATCAATGAAGGGAAAAATAAAATCCAAAGCCATAATTTCATCAAGTGATGACTC TTCGGATGAGGATAAACTTAAAATTGCTGATGAAGGACATCCCAGGAACAGCAACAGCAACAGTGACTCAGACGAGGACGAACAACGAAA GAAATGTGCCTCATCAGAGAGTGATTCCGATGAGAACCAGAACAAGTCTGGCAGCGAGGCCGGCAGTCCCCGGAGGCCACGAAGACAGCG GTCAGATCAGGACTCAGACAGTGACCAGCCATCCAGAAAGAGAAGGCCCTCCGGTTCTGAGCAGTCTGACAATGAATCTGTGCAGTCAGG GAGAAGCCACTCAGGAGTTTCTGAGAACGACTCTCGCCCAGCTTCTCCAAGTGCCGAATCAGATCACGAATCGGAGAGAGGATCTGATAA TGAGGGTTCTGGCCAAGGCTCTGGAAATGAATCGGAACCAGAGGGATCCAACAATGAGGCCTCAGATAGAGGCTCAGAACATGGGTCAGA TGATAGTGACTAGGTTTTATTTCATCAATAAGCTTCATCTCTGGAGGAAACTTTTTTAATATATGAAAGCTGTGATAAAAATGTTTCAGA TGTTTAGTCAATTGTGAAATTTTTCTTAAGGCAATTTTCTTTTCTATCAGTTTGTATATTACTAAGCCCCAAGAGACATTTCCTGTGCTA GAGTCCAATATTTGAGTCTCTCGTGCAAATGAGACTATTCTTTGTGGTACAATTCCACCTATCATATGTGAAAACTGCAGTAAAAATAAA CCCAGATGCTAAATCATTCCTACAAAGGTTTGACTGAAACTGTGGCAGATGTCTCATCTTCTTTATATGTTAAGCAGCATACTCTTCTGA TTTTTATTGCAATCTTTTACCAAGTGGTGCACAAACTTGGTATTGATGTCTTTATTCCATTTTGAGTTTAGATTGAGAATATTTTTATTT TCTGAAGGCAGAGATATCTACTGTATAATTGCACCAAAGTACATTTGAAAGGAAGGTTTTCAATAGTGTAATACTGCAGCGATGTAGATA AAATCACAAATGTATAATGTGTTAGGTTGAATAAGGTGTGGAAAATGCTTTTCTGTTAGTAGAATGCAAAAACCTACCTAAGCCACATAA >In-frame_ENST00000379719_ENST00000361367_TCGA-WE-A8K5-06A_IPO7_chr11_9406394_+_CTR9_chr11_10774219_length(amino acids)=1186AA_start in transcript=142_stop in transcript=3702 MDPNTIIEALRGTMDPALREAAERQLNEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEEFVKLLEAARIDGNLDYRD HEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALL GKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLAVLELNNKEADSIKNGVQL LSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSSFVLPFFGL GQMYIYRGDKENASQCFEKVLKAYPNNYETMKILGSLYAASEDQEKRDIAKGHLKKVTEQYPDDVEAWIELAQILEQTDIQGALSAYGTA TRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDRAKAEAEHDEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREH PNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSDTYSMLALGNVWLQTLHQ PTRDREKEKRHQDRALAIYKQVLRNDAKNLYAANGIGAVLAHKGYFREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENC LRKFYKHQNTEVVLYLARALFKCGKLQECKQTLLKARHVAPSDTVLMFNVALVLQRLATSVLKDEKSNLKEVLNAVKELELAHRYFSYLS KVGDKMRFDLALAATEARQCSDLLSQAQYHVARARKQDEEERELRAKQEQEKELLRQKLLKEQEEKRLREKEEQKKLLEQRAQYVEKTKN ILMFTGETEATKEKKRGGGGGRRSKKGGEFDEFVNDDTDDDLPISKKKKRRKGSGSEQEGEDEEGGERKKKKRRRHPKGEEGSDDDETEN GPKPKKRRPPKAEKKKAPKPERLPPSMKGKIKSKAIISSSDDSSDEDKLKIADEGHPRNSNSNSDSDEDEQRKKCASSESDSDENQNKSG SEAGSPRRPRRQRSDQDSDSDQPSRKRRPSGSEQSDNESVQSGRSHSGVSENDSRPASPSAESDHESERGSDNEGSGQGSGNESEPEGSN -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for IPO7-CTR9 |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for IPO7-CTR9 |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for IPO7-CTR9 |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Hgene | IPO7 | C0019693 | HIV Infections | 1 | CTD_human |
| Hgene | IPO7 | C4505456 | HIV Coinfection | 1 | CTD_human |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies