|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:NLK-ELMO1 (FusionGDB2 ID:58987) |
Fusion Gene Summary for NLK-ELMO1 |
Fusion gene summary |
Fusion gene information | Fusion gene name: NLK-ELMO1 | Fusion gene ID: 58987 | Hgene | Tgene | Gene symbol | NLK | ELMO1 | Gene ID | 51701 | 9844 |
Gene name | nemo like kinase | engulfment and cell motility 1 | |
Synonyms | - | CED-12|CED12|ELMO-1 | |
Cytomap | 17q11.2 | 7p14.2-p14.1 | |
Type of gene | protein-coding | protein-coding | |
Description | serine/threonine-protein kinase NLK | engulfment and cell motility protein 1ced-12 homolog 1 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q9UBE8 | Q92556 | |
Ensembl transtripts involved in fusion gene | ENST00000407008, ENST00000583517, ENST00000582037, | ENST00000341056, ENST00000396045, ENST00000310758, ENST00000396040, ENST00000442504, ENST00000448602, ENST00000479447, | |
Fusion gene scores | * DoF score | 18 X 10 X 9=1620 | 17 X 13 X 9=1989 |
# samples | 20 | 18 | |
** MAII score | log2(20/1620*10)=-3.01792190799726 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(18/1989*10)=-3.46597446450407 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: NLK [Title/Abstract] AND ELMO1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | NLK(26449758)-ELMO1(37172839), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | NLK | GO:0050821 | protein stabilization | 25512613 |
Fusion gene breakpoints across NLK (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across ELMO1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LGG | TCGA-FG-A70Z-01A | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
ChimerDB4 | LGG | TCGA-FG-A70Z-01A | NLK | chr17 | 26449758 | - | ELMO1 | chr7 | 37172839 | - |
Top |
Fusion Gene ORF analysis for NLK-ELMO1 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
In-frame | ENST00000407008 | ENST00000341056 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
5CDS-intron | ENST00000407008 | ENST00000396045 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
5CDS-intron | ENST00000407008 | ENST00000310758 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
5CDS-intron | ENST00000407008 | ENST00000396040 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
5CDS-intron | ENST00000407008 | ENST00000442504 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
5CDS-intron | ENST00000407008 | ENST00000448602 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
5CDS-intron | ENST00000407008 | ENST00000479447 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
intron-3CDS | ENST00000583517 | ENST00000341056 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
intron-intron | ENST00000583517 | ENST00000396045 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
intron-intron | ENST00000583517 | ENST00000310758 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
intron-intron | ENST00000583517 | ENST00000396040 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
intron-intron | ENST00000583517 | ENST00000442504 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
intron-intron | ENST00000583517 | ENST00000448602 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
intron-intron | ENST00000583517 | ENST00000479447 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
intron-3CDS | ENST00000582037 | ENST00000341056 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
intron-intron | ENST00000582037 | ENST00000396045 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
intron-intron | ENST00000582037 | ENST00000310758 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
intron-intron | ENST00000582037 | ENST00000396040 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
intron-intron | ENST00000582037 | ENST00000442504 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
intron-intron | ENST00000582037 | ENST00000448602 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
intron-intron | ENST00000582037 | ENST00000479447 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000407008 | NLK | chr17 | 26449758 | + | ENST00000341056 | ELMO1 | chr7 | 37172839 | - | 3599 | 1306 | 718 | 2403 | 561 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000407008 | ENST00000341056 | NLK | chr17 | 26449758 | + | ELMO1 | chr7 | 37172839 | - | 0.00708279 | 0.9929172 |
Top |
Fusion Genomic Features for NLK-ELMO1 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for NLK-ELMO1 |
Go to FGviewer for the breakpoints of chr17:26449758-chr7:37172839 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
NLK | ELMO1 |
FUNCTION: Serine/threonine-protein kinase that regulates a number of transcription factors with key roles in cell fate determination. Positive effector of the non-canonical Wnt signaling pathway, acting downstream of WNT5A, MAP3K7/TAK1 and HIPK2. Negative regulator of the canonical Wnt/beta-catenin signaling pathway. Binds to and phosphorylates TCF7L2/TCF4 and LEF1, promoting the dissociation of the TCF7L2/LEF1/beta-catenin complex from DNA, as well as the ubiquitination and subsequent proteolysis of LEF1. Together these effects inhibit the transcriptional activation of canonical Wnt/beta-catenin target genes. Negative regulator of the Notch signaling pathway. Binds to and phosphorylates NOTCH1, thereby preventing the formation of a transcriptionally active ternary complex of NOTCH1, RBPJ/RBPSUH and MAML1. Negative regulator of the MYB family of transcription factors. Phosphorylation of MYB leads to its subsequent proteolysis while phosphorylation of MYBL1 and MYBL2 inhibits their interaction with the coactivator CREBBP. Other transcription factors may also be inhibited by direct phosphorylation of CREBBP itself. Acts downstream of IL6 and MAP3K7/TAK1 to phosphorylate STAT3, which is in turn required for activation of NLK by MAP3K7/TAK1. Upon IL1B stimulus, cooperates with ATF5 to activate the transactivation activity of C/EBP subfamily members. Phosphorylates ATF5 but also stabilizes ATF5 protein levels in a kinase-independent manner (PubMed:25512613). {ECO:0000250|UniProtKB:O54949, ECO:0000269|PubMed:12482967, ECO:0000269|PubMed:14960582, ECO:0000269|PubMed:15004007, ECO:0000269|PubMed:15764709, ECO:0000269|PubMed:20061393, ECO:0000269|PubMed:20118921, ECO:0000269|PubMed:20874444, ECO:0000269|PubMed:21454679, ECO:0000269|PubMed:25512613}. | FUNCTION: Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Acts in association with DOCK1 and CRK. Was initially proposed to be required in complex with DOCK1 to activate Rac Rho small GTPases. May enhance the guanine nucleotide exchange factor (GEF) activity of DOCK1. {ECO:0000269|PubMed:11595183, ECO:0000269|PubMed:12134158}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | NLK | chr17:26449758 | chr7:37172839 | ENST00000407008 | + | 2 | 11 | 106_111 | 196.0 | 528.0 | Compositional bias | Note=Poly-Ala |
Hgene | NLK | chr17:26449758 | chr7:37172839 | ENST00000407008 | + | 2 | 11 | 115_119 | 196.0 | 528.0 | Compositional bias | Note=Poly-Ala |
Hgene | NLK | chr17:26449758 | chr7:37172839 | ENST00000407008 | + | 2 | 11 | 22_25 | 196.0 | 528.0 | Compositional bias | Note=Poly-Ala |
Hgene | NLK | chr17:26449758 | chr7:37172839 | ENST00000407008 | + | 2 | 11 | 27_34 | 196.0 | 528.0 | Compositional bias | Note=Poly-His |
Hgene | NLK | chr17:26449758 | chr7:37172839 | ENST00000407008 | + | 2 | 11 | 42_48 | 196.0 | 528.0 | Compositional bias | Note=Poly-His |
Hgene | NLK | chr17:26449758 | chr7:37172839 | ENST00000407008 | + | 2 | 11 | 71_83 | 196.0 | 528.0 | Compositional bias | Note=Poly-Ala |
Hgene | NLK | chr17:26449758 | chr7:37172839 | ENST00000407008 | + | 2 | 11 | 144_152 | 196.0 | 528.0 | Nucleotide binding | ATP |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000310758 | 12 | 22 | 555_676 | 362.0 | 728.0 | Domain | Note=PH | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000341056 | 0 | 10 | 319_492 | 64.0 | 430.0 | Domain | ELMO | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000341056 | 0 | 10 | 555_676 | 64.0 | 430.0 | Domain | Note=PH | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000396040 | 0 | 7 | 319_492 | 0 | 248.0 | Domain | ELMO | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000396040 | 0 | 7 | 555_676 | 0 | 248.0 | Domain | Note=PH | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000396045 | 0 | 7 | 319_492 | 0 | 248.0 | Domain | ELMO | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000396045 | 0 | 7 | 555_676 | 0 | 248.0 | Domain | Note=PH | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000442504 | 12 | 22 | 555_676 | 362.0 | 728.0 | Domain | Note=PH | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000448602 | 12 | 22 | 555_676 | 362.0 | 728.0 | Domain | Note=PH | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000310758 | 12 | 22 | 707_714 | 362.0 | 728.0 | Motif | Note=SH3-binding | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000341056 | 0 | 10 | 707_714 | 64.0 | 430.0 | Motif | Note=SH3-binding | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000396040 | 0 | 7 | 707_714 | 0 | 248.0 | Motif | Note=SH3-binding | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000396045 | 0 | 7 | 707_714 | 0 | 248.0 | Motif | Note=SH3-binding | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000442504 | 12 | 22 | 707_714 | 362.0 | 728.0 | Motif | Note=SH3-binding | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000448602 | 12 | 22 | 707_714 | 362.0 | 728.0 | Motif | Note=SH3-binding |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | NLK | chr17:26449758 | chr7:37172839 | ENST00000407008 | + | 2 | 11 | 138_427 | 196.0 | 528.0 | Domain | Protein kinase |
Hgene | NLK | chr17:26449758 | chr7:37172839 | ENST00000407008 | + | 2 | 11 | 298_300 | 196.0 | 528.0 | Motif | Note=TQE |
Hgene | NLK | chr17:26449758 | chr7:37172839 | ENST00000407008 | + | 2 | 11 | 428_527 | 196.0 | 528.0 | Region | Required for homodimerization and kinase activation and localization to the nucleus |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000310758 | 12 | 22 | 319_492 | 362.0 | 728.0 | Domain | ELMO | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000442504 | 12 | 22 | 319_492 | 362.0 | 728.0 | Domain | ELMO | |
Tgene | ELMO1 | chr17:26449758 | chr7:37172839 | ENST00000448602 | 12 | 22 | 319_492 | 362.0 | 728.0 | Domain | ELMO |
Top |
Fusion Gene Sequence for NLK-ELMO1 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>In-frame_ENST00000407008_ENST00000341056_TCGA-FG-A70Z-01A_NLK_chr17_26449758_+_ELMO1_chr7_37172839_length(transcript)=3599nt_BP=1306nt CCCCGGCTCTCTTTCTCCTCTCTGTCCTGCTGTCGCCTCCTCTCCTCACTCCAGCCTCCTTCCCTGGCTTATTCTGCCCAGGAAAGTTTG GAACCCCCGCCCCCCCTCCCCAATCAGGTCAACCTGACTAGGAGTAGGGGGAGATGTAGGAAGGCCTGAGAGTTCGGGGGGGGGGAAGCT GGAAGCTGGTTTCCCAGAAAATTTCCCCCCATCTTCTCCATTTAGGGTGGTGGGAATTTTTTTTAATCCTGTTTTTGAGGAGGTGGTAGG TGTTTAGAAAAGGATGTGGGAATGGAAGGGGTAGATGAGTCAACCCTCTTTCAAGATTCCAAGGGTGGTGTGTTACCTGATCCTTTTCGT GTGTGGAGTTCAGGGGGTCGGGAGGTTTGGCCTTTATTCCCACATTCAAAGTTGGAACCTCCCCCAAATTAAGAATGGAGTTTTAGTACC CACTTGTGGCAGGAATCCTGGGGGGAAGGGGTCCTTTTTTCCTTTTTCTTTTCTTTTTTCCCTTTTTTTTCCTTTTGGCAACCCACACCC TTCCACACACGCTCACCCCAAAATTAAACACCAAGATCCTCTAACTTGTTTGGATTGACTGATGAAGACATAAAGCTCTATGTTTTTTGA GGTGGAGTGAGTGGTTTTTCTTCATTTTTAAATGGCCAAATGACAGCTTGACCCAGTTTGCTTTCCAATCAAAGGGCATTTATTTTGAAT GTCTCTTTGTGGCGCAAGAGCCAACGCAAAAATGATGGCGGCTTACAATGGCGGTACATCTGCAGCAGCAGCAGGTCACCACCACCACCA TCACCACCACCTTCCACACCTCCCTCCTCCTCACCTGCACCACCACCACCACCCTCAACACCATCTTCATCCGGGGTCGGCTGCCGCTGT ACACCCTGTACAGCAGCACACCTCTTCGGCAGCTGCGGCAGCCGCAGCAGCGGCTGCAGCTGCAGCCATGTTAAACCCTGGGCAACAACA GCCATATTTCCCATCACCGGCACCGGGGCAGGCTCCTGGACCAGCTGCAGCAGCCCCAGCTCAGGTACAGGCTGCCGCAGCTGCTACAGT TAAGGCGCACCATCATCAGCACTCGCATCATCCACAGCAGCAGCTGGATATTGAGCCGGATAGACCTATTGGATATGGAGCCTTTGGTGT TGTCTGGTCAGTAACAGATCCAAGAGATGGAAAGAGAGTAGCGCTCAAAAAGATGCCCAACGTCTTCCAGAATCTGGTCTCTTGCAAAAG GGTCTTCCGGGAATTGAAGATGTTGTGTTTTTTTAAGCATGATAATAATCATGTCAACCCTGCCATGGACTTCACGCAGACTCCACCTGG GATGTTGGCTCTGGACAACATGCTGTACTTTGCCAAGCACCACCAAGATGCCTACATCCGGATTGTGCTTGAGAACAGTAGTCGAGAAGA CAAGCATGAATGTCCCTTTGGCCGCAGTAGTATAGAGCTGACCAAGATGCTATGTGAGATCTTGAAAGTGGGCGAGTTGCCTAGTGAGAC CTGCAACGACTTCCACCCGATGTTCTTCACCCACGACAGATCCTTTGAGGAGTTTTTCTGCATCTGTATCCAGCTCCTGAACAAGACATG GAAGGAAATGAGGGCAACTTCTGAAGACTTCAACAAGGTAATGCAGGTGGTGAAGGAGCAGGTTATGAGAGCACTTACAACCAAGCCTAG CTCCCTGGACCAGTTCAAGAGCAAACTGCAGAACCTGAGCTACACTGAGATCCTGAAAATCCGCCAGTCCGAGAGGATGAACCAGGAAGA TTTCCAGTCCCGCCCGATTTTGGAACTAAAGGAGAAGATTCAGCCAGAAATCTTAGAGCTGATCAAACAGCAACGCCTGAACCGCCTTGT GGAAGGGACCTGCTTTAGGAAACTCAATGCCCGGCGGAGGCAAGACAAGTTTTGGTATTGTCGGCTTTCGCCAAATCACAAAGTCCTGCA TTACGGAGACTTAGAAGAGAGTCCTCAGGGAGAAGTGCCCCACGATTCCTTGCAGGACAAACTGCCGGTGGCAGATATCAAAGCCGTGGT GACGGGAAAGGACTGCCCTCATATGAAAGAGAAAGGTGCCCTTAAACAAAACAAGGAGGTGCTTGAACTCGCTTTCTCCATCTTGTATGA CTCAAACTGCCAACTGAACTTCATCGCTCCTGACAAGCATGAGTACTGTATCTGGACGGATGGACTGAATGCGCTACTCGGGAAGGACAT GATGAGCGACCTGACGCGGAATGACCTGGACACCCTGCTCAGCATGGAAATCAAGCTCCGCCTCCTGGACCTGGAAAACATCCAGATCCC TGACGCACCTCCGCCGATTCCCAAGGAGCCCAGCAACTATGACTTCGTCTATGACTGTAACTGAAGTGGCCGGGCCCAGACATGCCCCTT CCAAAACTGGAACACCTAGCTAACAGGAGAGAGGAATGAAAACACACCCACGCCTTGGAACCGTCCTTTGGTAAAGGGAAGCTGTGGGTC CACATTCCCTTCAGCATCACCTCTAGCCCTGGCAACTTTCAGCCCCTAGCTGGCATCTTGCTCACCGCCCTGATTCTGTTCCTCGGCTCC ACTGCTTCAGGTCACTTCCCATGGCTGCAGTCCACTGGTGGGACAAGAGCAAAGCCCACTGCCAGTAAGAAGGCCAAAGGGCCCTTCCAT CCTAGCCCTCTGCAGGCATGCCCTTCCTTCCCTTGGGCAGGAAAGCCAGCAGCCCCAGACTGCCCAAAAACTTGCCCACCAGACCAAGGG CAGTGCCCCAAGGCCCCTGTCTGGAGGAAATGGCCTAGCTATTTGATGAGAAGACCAAACCCCACATCCTCCTTTCCCCTCTCTCTAGAA TCATCTCGCACCACCAGTTACACTTGAATTAAGATCTGCGCTCAAATCTCCTCCCACCTCTCTCCCTGCTTTTGCCTTGCTCTGTTCCTC TTTGGTCCCAAGAGCAGCAGCCGCAGCCTCCTCGTGATCCTCCCTAGCATAAATTTCCCAAACAGTCCACAGGTCCCATGCCCACTTTGC GTCTGCACTGTGATCGTGACAAATCTTCCCTCCTCACCAGCTAGTCTGGGGTTTCCTCTCCCTGCCCCAGGCCAGAACTGCCTTCTTCAT TTCCACCCACGCTCCCAGCCTCTTAGCTGAAAGCACAAATGGTGAAATCAGTAGTCTCGCTCCATCTCTAATAGACTAAACCTAAATGCC TCTAGGACGGACTGTTGCTATCCAAGCGTTTGGTGTTACCTTCTCCTGGGAGGTCCTGCTGCAACTCAAGTTCCACAGGATGGTCAAGCT GTCAGACATCCAAGTTTACATCATTGTAATTATTACTGGTATTTACAATTTGCAAGAGTTTTGGGTTAGTTTTTTTTTTTTTTTTTGCTT TGTTTTTGTACAAAAGAGTCTAACATTTTTTGCCAAACAGATATATATTTAATGAAAAGAAGAGATACATAAATGTGTGAATTTCCAGTT >In-frame_ENST00000407008_ENST00000341056_TCGA-FG-A70Z-01A_NLK_chr17_26449758_+_ELMO1_chr7_37172839_length(amino acids)=561AA_start in transcript=718_stop in transcript=2403 MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAAVHPVQQHTSSAAAAAAAAAAAAAMLNPGQQ QPYFPSPAPGQAPGPAAAAPAQVQAAAAATVKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK RVFRELKMLCFFKHDNNHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIELTKMLCEILKVGELPSE TCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKVMQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQE DFQSRPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAV VTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQI -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for NLK-ELMO1 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for NLK-ELMO1 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for NLK-ELMO1 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Tgene | ELMO1 | C0011881 | Diabetic Nephropathy | 1 | CTD_human |
Tgene | ELMO1 | C0014518 | Toxic Epidermal Necrolysis | 1 | CTD_human |
Tgene | ELMO1 | C0017667 | Nodular glomerulosclerosis | 1 | CTD_human |
Tgene | ELMO1 | C0038325 | Stevens-Johnson Syndrome | 1 | CTD_human |
Tgene | ELMO1 | C0279628 | Adenocarcinoma Of Esophagus | 1 | CTD_human |
Tgene | ELMO1 | C1274933 | Drug-Induced Stevens Johnson Syndrome | 1 | CTD_human |
Tgene | ELMO1 | C3658301 | Mycoplasma-Induced Stevens-Johnson Syndrome | 1 | CTD_human |
Tgene | ELMO1 | C3658302 | Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum | 1 | CTD_human |