|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:PIK3CB-COPB2 (FusionGDB2 ID:64962) |
Fusion Gene Summary for PIK3CB-COPB2 |
Fusion gene summary |
Fusion gene information | Fusion gene name: PIK3CB-COPB2 | Fusion gene ID: 64962 | Hgene | Tgene | Gene symbol | PIK3CB | COPB2 | Gene ID | 5291 | 9276 |
Gene name | phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta | COPI coat complex subunit beta 2 | |
Synonyms | P110BETA|PI3K|PI3KBETA|PIK3C1 | MCPH19|beta'-COP | |
Cytomap | 3q22.3 | 3q23 | |
Type of gene | protein-coding | protein-coding | |
Description | phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoformPI3-kinase p110 subunit betaPI3-kinase subunit betaPI3K-betaPtdIns-3-kinase p110phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit betaphosphoinositid | coatomer subunit beta'beta'-coat proteinbetaprime-COPcoatomer binding complex, beta prime subunitcoatomer protein complex subunit beta 2coatomer protein complex subunit beta primecoatomer protein complex, subunit beta 2 (beta prime)p102 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | . | P35606 | |
Ensembl transtripts involved in fusion gene | ENST00000477593, ENST00000544716, ENST00000289153, | ENST00000333188, ENST00000507777, ENST00000510491, | |
Fusion gene scores | * DoF score | 15 X 13 X 11=2145 | 7 X 6 X 2=84 |
# samples | 17 | 7 | |
** MAII score | log2(17/2145*10)=-3.65737099624921 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(7/84*10)=-0.263034405833794 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: PIK3CB [Title/Abstract] AND COPB2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | PIK3CB(138478015)-COPB2(139102277), # samples:3 | ||
Anticipated loss of major functional domain due to fusion event. | PIK3CB-COPB2 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. PIK3CB-COPB2 seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. PIK3CB-COPB2 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. PIK3CB-COPB2 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | PIK3CB | GO:0016310 | phosphorylation | 25327288 |
Tgene | COPB2 | GO:0006891 | intra-Golgi vesicle-mediated transport | 8335000 |
Fusion gene breakpoints across PIK3CB (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across COPB2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BRCA | TCGA-EW-A3E8-01B | PIK3CB | chr3 | 138478015 | - | COPB2 | chr3 | 139102277 | - |
ChimerDB4 | BRCA | TCGA-EW-A3E8-01B | PIK3CB | chr3 | 138478015 | - | COPB2 | chr3 | 139102277 | - |
ChimerDB4 | BRCA | TCGA-EW-A3E8-01B | PIK3CB | chr3 | 138478015 | - | COPB2 | chr3 | 139102277 | - |
Top |
Fusion Gene ORF analysis for PIK3CB-COPB2 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
Frame-shift | ENST00000477593 | ENST00000333188 | PIK3CB | chr3 | 138478015 | - | COPB2 | chr3 | 139102277 | - |
5CDS-5UTR | ENST00000477593 | ENST00000507777 | PIK3CB | chr3 | 138478015 | - | COPB2 | chr3 | 139102277 | - |
5CDS-5UTR | ENST00000477593 | ENST00000510491 | PIK3CB | chr3 | 138478015 | - | COPB2 | chr3 | 139102277 | - |
intron-3CDS | ENST00000544716 | ENST00000333188 | PIK3CB | chr3 | 138478015 | - | COPB2 | chr3 | 139102277 | - |
intron-5UTR | ENST00000544716 | ENST00000507777 | PIK3CB | chr3 | 138478015 | - | COPB2 | chr3 | 139102277 | - |
intron-5UTR | ENST00000544716 | ENST00000510491 | PIK3CB | chr3 | 138478015 | - | COPB2 | chr3 | 139102277 | - |
In-frame | ENST00000289153 | ENST00000333188 | PIK3CB | chr3 | 138478015 | - | COPB2 | chr3 | 139102277 | - |
5CDS-5UTR | ENST00000289153 | ENST00000507777 | PIK3CB | chr3 | 138478015 | - | COPB2 | chr3 | 139102277 | - |
5CDS-5UTR | ENST00000289153 | ENST00000510491 | PIK3CB | chr3 | 138478015 | - | COPB2 | chr3 | 139102277 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000289153 | PIK3CB | chr3 | 138478015 | - | ENST00000333188 | COPB2 | chr3 | 139102277 | - | 3346 | 171 | 0 | 2888 | 962 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000289153 | ENST00000333188 | PIK3CB | chr3 | 138478015 | - | COPB2 | chr3 | 139102277 | - | 0.000670865 | 0.9993292 |
Top |
Fusion Genomic Features for PIK3CB-COPB2 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for PIK3CB-COPB2 |
Go to FGviewer for the breakpoints of chr3:138478015-chr3:139102277 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
. | COPB2 |
FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors (By similarity). {ECO:0000250}.; FUNCTION: This coatomer complex protein, essential for Golgi budding and vesicular trafficking, is a selective binding protein (RACK) for protein kinase C, epsilon type. It binds to Golgi membranes in a GTP-dependent manner (By similarity). {ECO:0000250}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | COPB2 | chr3:138478015 | chr3:139102277 | ENST00000333188 | 0 | 22 | 866_891 | 1.0 | 907.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | COPB2 | chr3:138478015 | chr3:139102277 | ENST00000333188 | 0 | 22 | 13_52 | 1.0 | 907.0 | Repeat | Note=WD 1 | |
Tgene | COPB2 | chr3:138478015 | chr3:139102277 | ENST00000333188 | 0 | 22 | 140_180 | 1.0 | 907.0 | Repeat | Note=WD 4 | |
Tgene | COPB2 | chr3:138478015 | chr3:139102277 | ENST00000333188 | 0 | 22 | 183_224 | 1.0 | 907.0 | Repeat | Note=WD 5 | |
Tgene | COPB2 | chr3:138478015 | chr3:139102277 | ENST00000333188 | 0 | 22 | 227_266 | 1.0 | 907.0 | Repeat | Note=WD 6 | |
Tgene | COPB2 | chr3:138478015 | chr3:139102277 | ENST00000333188 | 0 | 22 | 55_94 | 1.0 | 907.0 | Repeat | Note=WD 2 | |
Tgene | COPB2 | chr3:138478015 | chr3:139102277 | ENST00000333188 | 0 | 22 | 97_136 | 1.0 | 907.0 | Repeat | Note=WD 3 |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000289153 | - | 1 | 22 | 194_285 | 57.0 | 1071.0 | Domain | PI3K-RBD |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000289153 | - | 1 | 22 | 26_115 | 57.0 | 1071.0 | Domain | PI3K-ABD |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000289153 | - | 1 | 22 | 327_496 | 57.0 | 1071.0 | Domain | C2 PI3K-type |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000289153 | - | 1 | 22 | 524_701 | 57.0 | 1071.0 | Domain | PIK helical |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000289153 | - | 1 | 22 | 800_1067 | 57.0 | 1071.0 | Domain | PI3K/PI4K |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000477593 | - | 2 | 23 | 194_285 | 57.0 | 1071.0 | Domain | PI3K-RBD |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000477593 | - | 2 | 23 | 26_115 | 57.0 | 1071.0 | Domain | PI3K-ABD |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000477593 | - | 2 | 23 | 327_496 | 57.0 | 1071.0 | Domain | C2 PI3K-type |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000477593 | - | 2 | 23 | 524_701 | 57.0 | 1071.0 | Domain | PIK helical |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000477593 | - | 2 | 23 | 800_1067 | 57.0 | 1071.0 | Domain | PI3K/PI4K |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000289153 | - | 1 | 22 | 410_418 | 57.0 | 1071.0 | Motif | Note=Nuclear localization signal |
Hgene | PIK3CB | chr3:138478015 | chr3:139102277 | ENST00000477593 | - | 2 | 23 | 410_418 | 57.0 | 1071.0 | Motif | Note=Nuclear localization signal |
Top |
Fusion Gene Sequence for PIK3CB-COPB2 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>In-frame_ENST00000289153_ENST00000333188_TCGA-EW-A3E8-01B_PIK3CB_chr3_138478015_-_COPB2_chr3_139102277_length(transcript)=3346nt_BP=171nt ATGTGCTTCAGTTTCATAATGCCTCCTGCTATGGCAGACATCCTTGACATCTGGGCGGTGGATTCACAGATAGCATCTGATGGCTCCATA CCTGTGGATTTCCTTTTGCCCACTGGGATTTATATCCAGTTGGAGGTACCTCGGGAAGCTACCATTTCTTATATTAAGCAGCCTCTGCGA CTTGATATCAAAAGAAAGCTAACTGCTAGATCTGATCGAGTTAAGAGTGTGGATCTGCATCCTACAGAGCCATGGATGTTGGCAAGTCTT TACAATGGCAGTGTGTGTGTTTGGAATCATGAAACACAGACACTGGTGAAGACATTTGAAGTATGTGATCTTCCTGTTCGAGCTGCAAAG TTTGTTGCAAGGAAGAATTGGGTTGTGACAGGAGCGGATGACATGCAGATTAGAGTGTTCAATTACAATACTCTGGAGAGAGTTCATATG TTTGAAGCACACTCAGACTACATTCGCTGTATTGCTGTTCATCCAACCCAGCCTTTCATTCTAACTAGCAGTGATGACATGCTTATTAAG CTCTGGGACTGGGATAAAAAATGGTCTTGCTCACAAGTGTTTGAAGGACACACCCATTATGTTATGCAGATTGTGATCAACCCCAAAGAT AACAATCAGTTTGCCAGTGCCTCTTTGGACAGGACTATCAAGGTGTGGCAGTTGGGCTCTTCGTCACCAAACTTCACTTTGGAAGGACAT GAGAAAGGCGTGAATTGCATTGATTACTACAGTGGTGGGGACAAGCCATACCTCATTTCAGGTGCAGATGACCGTCTTGTTAAAATATGG GATTATCAGAATAAAACATGTGTGCAGACACTGGAAGGACATGCCCAAAATGTGTCTTGTGCCAGCTTTCATCCTGAGTTGCCAATCATT ATCACAGGTTCAGAAGATGGAACAGTACGTATTTGGCATTCAAGCACCTACCGGCTTGAGAGCACACTGAATTATGGAATGGAGAGGGTA TGGTGCGTGGCCAGTCTAAGAGGGTCAAACAATGTCGCTTTGGGCTATGATGAAGGGAGCATCATTGTTAAGCTTGGTCGGGAGGAACCT GCCATGTCCATGGATGCCAATGGAAAGATAATTTGGGCCAAGCATTCAGAAGTCCAGCAGGCCAACCTAAAAGCAATGGGAGATGCTGAA ATTAAAGATGGTGAAAGATTGCCACTGGCAGTAAAGGATATGGGCAGTTGTGAAATATACCCTCAGACTATTCAGCACAATCCTAATGGG CGGTTTGTGGTGGTGTGTGGTGATGGGGAGTATATCATCTACACAGCAATGGCATTGAGAAACAAGAGCTTTGGATCTGCTCAGGAGTTT GCATGGGCCCACGATTCTTCAGAGTATGCAATAAGAGAGAGCAACAGCATTGTAAAGATATTTAAGAACTTTAAGGAAAAAAAATCATTT AAACCAGATTTTGGAGCAGAAAGTATCTACGGCGGCTTCTTATTGGGAGTCAGATCTGTAAATGGCTTAGCCTTCTATGACTGGGACAAT ACAGAACTCATACGAAGAATTGAAATTCAGCCCAAACATATTTTCTGGTCTGACTCTGGAGAGCTAGTCTGTATTGCTACTGAGGAATCA TTTTTTATCCTTAAGTATCTGTCAGAAAAAGTCTTGGCTGCACAGGAAACACATGAGGGAGTTACTGAAGATGGCATTGAAGATGCCTTT GAGGTTCTTGGTGAGATTCAGGAAATTGTGAAAACAGGGCTTTGGGTAGGCGATTGCTTCATTTACACAAGTTCTGTGAACAGATTAAAT TATTATGTTGGAGGAGAAATAGTCACCATTGCCCACTTGGACAGGACGATGTATCTCCTAGGCTACATTCCTAAAGACAACAGGCTTTAT CTGGGGGATAAAGAATTGAACATCATTAGCTATTCCCTGCTGGTTTCAGTCCTGGAATACCAGACAGCTGTCATGCGGAGGGACTTTAGC ATGGCTGATAAGGTCCTTCCTACCATTCCAAAAGAACAGAGGACCAGAGTTGCACACTTTTTGGAAAAGCAGGGCTTCAAGCAGCAAGCT CTTACAGTATCCACAGATCCTGAGCATCGTTTTGAGCTTGCTCTTCAGCTTGGAGAGTTAAAAATTGCATACCAGTTAGCAGTGGAAGCA GAGTCAGAACAGAAGTGGAAACAACTTGCTGAACTTGCCATTAGTAAATGTCAGTTTGGCCTAGCCCAGGAGTGCCTGCATCATGCACAG GATTATGGGGGCCTGCTGCTTTTGGCCACTGCCTCTGGAAATGCTAATATGGTGAACAAGCTAGCAGAGGGTGCGGAGAGAGATGGCAAA AATAATGTGGCATTCATGAGCTACTTTTTACAGGGCAAGGTTGATGCCTGCCTAGAGCTCTTAATTAGAACTGGACGGCTGCCAGAAGCT GCCTTCTTGGCCCGAACTTACTTACCCAGTCAGGTTTCAAGGGTAGTGAAACTCTGGAGAGAGAATCTCTCAAAAGTCAATCAGAAAGCA GCAGAATCCCTTGCTGACCCAACAGAGTATGAAAACCTGTTCCCTGGATTAAAAGAAGCCTTTGTTGTTGAAGAATGGGTGAAGGAAACA CATGCTGATCTGTGGCCAGCCAAACAATACCCACTTGTCACGCCAAATGAAGAGAGAAATGTCATGGAAGAGGGAAAAGACTTTCAGCCC TCAAGATCTACAGCTCAACAGGAACTTGATGGGAAACCTGCTTCTCCTACTCCGGTTATTGTGGCCTCCCACACAGCCAACAAAGAAGAA AAGAGTTTACTCGAACTAGAAGTAGATTTGGATAATTTGGAATTAGAAGATATTGACACAACAGATATCAATCTGGATGAAGATATTTTG GATGATTGACTGTAATGCTTTCCATTTACCTGACTAAACAGATCATTATTATATATAGGTATTGATTGCTACCCTGACCACAGTGCTTTG GACTATGAGAAACTTCTTAGATTTTTATATGTAAATGCTGTGGACCACTGGGAGCACAATGCCCACATCATCTTAAGAAGAGTTTATGTG CAGCATTTAAATCACTGTGTTTTCCTTGTTAACTAAAACAGACATGGGCTTTGATTTTTTTCATACTATTAGACCATATCTCATAAAACC TTTTGAATTAATGAAGGTACTTGTTTCCTTTCTCAATAATGAAAATAGGCTTCTAGTTTTAGAAGGCTGAGCCGAAACTACACCTTGCCT AGGGATCAGCCCCACTGTCTTTTCTTTGTATAACTAAATCTGCATTTTCAAATGTTGTCAATCACATTTTTCTTAGAGCTGAATATCCAG >In-frame_ENST00000289153_ENST00000333188_TCGA-EW-A3E8-01B_PIK3CB_chr3_138478015_-_COPB2_chr3_139102277_length(amino acids)=962AA_start in transcript=0_stop in transcript=2888 MCFSFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQPLRLDIKRKLTARSDRVKSVDLHPTEPWMLASL YNGSVCVWNHETQTLVKTFEVCDLPVRAAKFVARKNWVVTGADDMQIRVFNYNTLERVHMFEAHSDYIRCIAVHPTQPFILTSSDDMLIK LWDWDKKWSCSQVFEGHTHYVMQIVINPKDNNQFASASLDRTIKVWQLGSSSPNFTLEGHEKGVNCIDYYSGGDKPYLISGADDRLVKIW DYQNKTCVQTLEGHAQNVSCASFHPELPIIITGSEDGTVRIWHSSTYRLESTLNYGMERVWCVASLRGSNNVALGYDEGSIIVKLGREEP AMSMDANGKIIWAKHSEVQQANLKAMGDAEIKDGERLPLAVKDMGSCEIYPQTIQHNPNGRFVVVCGDGEYIIYTAMALRNKSFGSAQEF AWAHDSSEYAIRESNSIVKIFKNFKEKKSFKPDFGAESIYGGFLLGVRSVNGLAFYDWDNTELIRRIEIQPKHIFWSDSGELVCIATEES FFILKYLSEKVLAAQETHEGVTEDGIEDAFEVLGEIQEIVKTGLWVGDCFIYTSSVNRLNYYVGGEIVTIAHLDRTMYLLGYIPKDNRLY LGDKELNIISYSLLVSVLEYQTAVMRRDFSMADKVLPTIPKEQRTRVAHFLEKQGFKQQALTVSTDPEHRFELALQLGELKIAYQLAVEA ESEQKWKQLAELAISKCQFGLAQECLHHAQDYGGLLLLATASGNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEA AFLARTYLPSQVSRVVKLWRENLSKVNQKAAESLADPTEYENLFPGLKEAFVVEEWVKETHADLWPAKQYPLVTPNEERNVMEEGKDFQP -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for PIK3CB-COPB2 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for PIK3CB-COPB2 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for PIK3CB-COPB2 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | PIK3CB | C0033578 | Prostatic Neoplasms | 1 | CTD_human |
Hgene | PIK3CB | C0036341 | Schizophrenia | 1 | CTD_human |
Hgene | PIK3CB | C0079744 | Diffuse Large B-Cell Lymphoma | 1 | CTD_human |
Hgene | PIK3CB | C0376358 | Malignant neoplasm of prostate | 1 | CTD_human |
Tgene | COPB2 | C3711387 | Autosomal Recessive Primary Microcephaly | 1 | ORPHANET |
Tgene | COPB2 | C4540488 | MICROCEPHALY 19, PRIMARY, AUTOSOMAL RECESSIVE | 1 | UNIPROT |