|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:ATG5-CDC123 (FusionGDB2 ID:7673) |
Fusion Gene Summary for ATG5-CDC123 |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: ATG5-CDC123 | Fusion gene ID: 7673 | Hgene | Tgene | Gene symbol | ATG5 | CDC123 | Gene ID | 9474 | 8872 |
| Gene name | autophagy related 5 | cell division cycle 123 | |
| Synonyms | APG5|APG5-LIKE|APG5L|ASP|SCAR25|hAPG5 | C10orf7|D123 | |
| Cytomap | 6q21 | 10p14-p13 | |
| Type of gene | protein-coding | protein-coding | |
| Description | autophagy protein 5APG5 autophagy 5-likeATG5 autophagy related 5 homologapoptosis-specific protein | cell division cycle protein 123 homologHT-1080PZ32cell division cycle 123 homolog | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q9H1Y0 | O75794 | |
| Ensembl transtripts involved in fusion gene | ENST00000343245, ENST00000369070, ENST00000369076, ENST00000360666, ENST00000475645, | ENST00000281141, ENST00000455773, ENST00000378900, | |
| Fusion gene scores | * DoF score | 25 X 16 X 9=3600 | 10 X 9 X 8=720 |
| # samples | 29 | 11 | |
| ** MAII score | log2(29/3600*10)=-3.6338721012021 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(11/720*10)=-2.71049338280502 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context | PubMed: ATG5 [Title/Abstract] AND CDC123 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | ATG5(106763975)-CDC123(12259359), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | ATG5-CDC123 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Fusion gene breakpoints across ATG5 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Fusion gene breakpoints across CDC123 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | LGG | TCGA-DU-7010 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
Top |
Fusion Gene ORF analysis for ATG5-CDC123 |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| In-frame | ENST00000343245 | ENST00000281141 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
| 5CDS-3UTR | ENST00000343245 | ENST00000455773 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
| 5CDS-3UTR | ENST00000343245 | ENST00000378900 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
| Frame-shift | ENST00000369070 | ENST00000281141 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
| 5CDS-3UTR | ENST00000369070 | ENST00000455773 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
| 5CDS-3UTR | ENST00000369070 | ENST00000378900 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
| Frame-shift | ENST00000369076 | ENST00000281141 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
| 5CDS-3UTR | ENST00000369076 | ENST00000455773 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
| 5CDS-3UTR | ENST00000369076 | ENST00000378900 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
| In-frame | ENST00000360666 | ENST00000281141 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
| 5CDS-3UTR | ENST00000360666 | ENST00000455773 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
| 5CDS-3UTR | ENST00000360666 | ENST00000378900 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
| intron-3CDS | ENST00000475645 | ENST00000281141 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
| intron-3UTR | ENST00000475645 | ENST00000455773 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
| intron-3UTR | ENST00000475645 | ENST00000378900 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000343245 | ATG5 | chr6 | 106763975 | - | ENST00000281141 | CDC123 | chr10 | 12259359 | + | 1237 | 308 | 200 | 985 | 261 |
| ENST00000360666 | ATG5 | chr6 | 106763975 | - | ENST00000281141 | CDC123 | chr10 | 12259359 | + | 1227 | 298 | 190 | 975 | 261 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000343245 | ENST00000281141 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + | 0.000362434 | 0.9996376 |
| ENST00000360666 | ENST00000281141 | ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + | 0.000669962 | 0.99933004 |
Top |
Fusion Genomic Features for ATG5-CDC123 |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + | 0.001088379 | 0.9989116 |
| ATG5 | chr6 | 106763975 | - | CDC123 | chr10 | 12259359 | + | 0.001088379 | 0.9989116 |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for ATG5-CDC123 |
| Go to FGviewer for the breakpoints of chr6:106763975-chr10:12259359 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| ATG5 | CDC123 |
| FUNCTION: Involved in autophagic vesicle formation. Conjugation with ATG12, through a ubiquitin-like conjugating system involving ATG7 as an E1-like activating enzyme and ATG10 as an E2-like conjugating enzyme, is essential for its function. The ATG12-ATG5 conjugate acts as an E3-like enzyme which is required for lipidation of ATG8 family proteins and their association to the vesicle membranes. Involved in mitochondrial quality control after oxidative damage, and in subsequent cellular longevity. Plays a critical role in multiple aspects of lymphocyte development and is essential for both B and T lymphocyte survival and proliferation. Required for optimal processing and presentation of antigens for MHC II. Involved in the maintenance of axon morphology and membrane structures, as well as in normal adipocyte differentiation. Promotes primary ciliogenesis through removal of OFD1 from centriolar satellites and degradation of IFT20 via the autophagic pathway. {ECO:0000250|UniProtKB:Q99J83, ECO:0000269|PubMed:12207896, ECO:0000269|PubMed:20580051, ECO:0000269|PubMed:22170153, ECO:0000269|PubMed:26812546}.; FUNCTION: May play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity. Plays a crucial role in IFN-gamma-induced autophagic cell death by interacting with FADD. {ECO:0000269|PubMed:15778222, ECO:0000269|PubMed:7796880}.; FUNCTION: (Microbial infection) May act as a proviral factor. In association with ATG12, negatively regulates the innate antiviral immune response by impairing the type I IFN production pathway upon vesicular stomatitis virus (VSV) infection (PubMed:17709747). Required for the translation of incoming hepatitis C virus (HCV) RNA and, thereby, for initiation of HCV replication, but not required once infection is established (PubMed:19666601). {ECO:0000269|PubMed:17709747, ECO:0000269|PubMed:19666601}. | FUNCTION: Required for S phase entry of the cell cycle. {ECO:0000250}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Top |
Fusion Gene Sequence for ATG5-CDC123 |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >In-frame_ENST00000343245_ENST00000281141_TCGA-DU-7010_ATG5_chr6_106763975_-_CDC123_chr10_12259359_length(transcript)=1237nt_BP=308nt GCCCGCCCGGCCGCGATGGCGGGTGAAGGTGGTTCCTCCGGGCAAGGTGGAGTTGGCGAGACGCCGGCCCGGAGCCCTGGGGCCGGTTGG CGGGTGTGGCCTGCGGGGTCCCTCTTGGGGTACATGTCTGTTGCTTACTAAGTTTGGCTTTGGTTGAAATAAGAATTTAGCCTGTATGTA CTGCTTTAACTCCTGGAAGAATGACAGATGACAAAGATGTGCTTCGAGATGTGTGGTTTGGACGAATTCCAACTTGTTTCACGCTATATC AGGATGAGATAACTGAAAGGGAAGCAGAACCATACTATGATGCGTATTGGATAGCAATGAATAGTTCTCTGAAATGTAAAACCCTCAGCG ACATCTTTCTGCTTTTCAAGAGTTCCGATTTCATCACTCGTGACTTCACTCAGCCGTTTATTCATTGTACTGATGATTCTCCAGATCCAT GTATAGAATATGAGCTCGTTCTCCGAAAATGGTGTGAATTGATTCCTGGGGCTGAGTTTCGATGTTTTGTCAAGGAAAACAAGCTTATTG GTATTTCTCAAAGAGACTACACACAATACTATGATCATATTTCTAAACAAAAGGAAGAAATTCGCAGATGCATACAAGACTTTTTCAAGA AACACATACAGTACAAATTCTTAGATGAAGACTTTGTGTTCGATATATACAGAGACAGTAGGGGGAAGGTGTGGCTCATTGACTTTAATC CATTTGGTGAAGTCACAGATTCACTGCTGTTCACCTGGGAAGAACTGATATCTGAGAACAACTTAAACGGCGATTTTAGTGAAGTTGACG CTCAAGAGCAGGATTCCCCAGCTTTCCGTTGCACAAACAGTGAAGTGACAGTCCAGCCCAGCCCCTATTTGAGTTACCGGCTACCCAAGG ACTTTGTAGACCTCTCTACTGGGGAGGACGCTCACAAGCTAATAGACTTCCTTAAGCTGAAGAGAAATCAGCAGGAGGACGACTGATGAG CGTACTGGAACTGGAGAAGAGGAGGCCCCGCCCCACCGCTCCGGGAGCTGCTCATCAGCCGCAACTTCCTGCCGACCCTGATGCGGGTGG GCCGAGCAGTGTGGACATCAGCCACTTTTTATATTCATGTACATTCACCTGGGGAAAAAAACGGAGGGACTTTGCTACTTGTAAAAATAA >In-frame_ENST00000343245_ENST00000281141_TCGA-DU-7010_ATG5_chr6_106763975_-_CDC123_chr10_12259359_length(amino acids)=261AA_start in transcript=200_stop in transcript=985 MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYDAYWIAMNSSLKCKTLSDIFLLFKSSDFITRDFTQPFIHCTDDSPDPCIEYELV LRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIRRCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTD -------------------------------------------------------------- >In-frame_ENST00000360666_ENST00000281141_TCGA-DU-7010_ATG5_chr6_106763975_-_CDC123_chr10_12259359_length(transcript)=1227nt_BP=298nt AGTCCTGCTACCGCGTCCCCGCAGGACAGTGTGTCAGGCGGGCAGCTTGCCCCGCCGCCCCACCGGAGCGCGGAATCTGGGCGTCCCCAC CAGTGCGGGGAGCCGGAAGGAGGAGCCATAGCTTGGAGTAGGTTTGGCTTTGGTTGAAATAAGAATTTAGCCTGTATGTACTGCTTTAAC TCCTGGAAGAATGACAGATGACAAAGATGTGCTTCGAGATGTGTGGTTTGGACGAATTCCAACTTGTTTCACGCTATATCAGGATGAGAT AACTGAAAGGGAAGCAGAACCATACTATGATGCGTATTGGATAGCAATGAATAGTTCTCTGAAATGTAAAACCCTCAGCGACATCTTTCT GCTTTTCAAGAGTTCCGATTTCATCACTCGTGACTTCACTCAGCCGTTTATTCATTGTACTGATGATTCTCCAGATCCATGTATAGAATA TGAGCTCGTTCTCCGAAAATGGTGTGAATTGATTCCTGGGGCTGAGTTTCGATGTTTTGTCAAGGAAAACAAGCTTATTGGTATTTCTCA AAGAGACTACACACAATACTATGATCATATTTCTAAACAAAAGGAAGAAATTCGCAGATGCATACAAGACTTTTTCAAGAAACACATACA GTACAAATTCTTAGATGAAGACTTTGTGTTCGATATATACAGAGACAGTAGGGGGAAGGTGTGGCTCATTGACTTTAATCCATTTGGTGA AGTCACAGATTCACTGCTGTTCACCTGGGAAGAACTGATATCTGAGAACAACTTAAACGGCGATTTTAGTGAAGTTGACGCTCAAGAGCA GGATTCCCCAGCTTTCCGTTGCACAAACAGTGAAGTGACAGTCCAGCCCAGCCCCTATTTGAGTTACCGGCTACCCAAGGACTTTGTAGA CCTCTCTACTGGGGAGGACGCTCACAAGCTAATAGACTTCCTTAAGCTGAAGAGAAATCAGCAGGAGGACGACTGATGAGCGTACTGGAA CTGGAGAAGAGGAGGCCCCGCCCCACCGCTCCGGGAGCTGCTCATCAGCCGCAACTTCCTGCCGACCCTGATGCGGGTGGGCCGAGCAGT GTGGACATCAGCCACTTTTTATATTCATGTACATTCACCTGGGGAAAAAAACGGAGGGACTTTGCTACTTGTAAAAATAACATAATAAAT >In-frame_ENST00000360666_ENST00000281141_TCGA-DU-7010_ATG5_chr6_106763975_-_CDC123_chr10_12259359_length(amino acids)=261AA_start in transcript=190_stop in transcript=975 MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYDAYWIAMNSSLKCKTLSDIFLLFKSSDFITRDFTQPFIHCTDDSPDPCIEYELV LRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIRRCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTD -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for ATG5-CDC123 |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for ATG5-CDC123 |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for ATG5-CDC123 |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Hgene | ATG5 | C0002871 | Anemia | 1 | CTD_human |
| Hgene | ATG5 | C0019193 | Hepatitis, Toxic | 1 | CTD_human |
| Hgene | ATG5 | C0019209 | Hepatomegaly | 1 | CTD_human |
| Hgene | ATG5 | C0023380 | Lethargy | 1 | CTD_human |
| Hgene | ATG5 | C0024312 | Lymphopenia | 1 | CTD_human |
| Hgene | ATG5 | C0027540 | Necrosis | 1 | CTD_human |
| Hgene | ATG5 | C0860207 | Drug-Induced Liver Disease | 1 | CTD_human |
| Hgene | ATG5 | C0919267 | ovarian neoplasm | 1 | CTD_human |
| Hgene | ATG5 | C1140680 | Malignant neoplasm of ovary | 1 | CTD_human |
| Hgene | ATG5 | C1262477 | Weight decreased | 1 | CTD_human |
| Hgene | ATG5 | C1262760 | Hepatitis, Drug-Induced | 1 | CTD_human |
| Hgene | ATG5 | C3658290 | Drug-Induced Acute Liver Injury | 1 | CTD_human |
| Hgene | ATG5 | C4277682 | Chemical and Drug Induced Liver Injury | 1 | CTD_human |
| Hgene | ATG5 | C4279912 | Chemically-Induced Liver Toxicity | 1 | CTD_human |
| Hgene | ATG5 | C4539808 | SPINOCEREBELLAR ATAXIA, AUTOSOMAL RECESSIVE 25 | 1 | UNIPROT |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies