|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:SLC7A5-ANP32A (FusionGDB2 ID:82903) |
Fusion Gene Summary for SLC7A5-ANP32A |
Fusion gene summary |
Fusion gene information | Fusion gene name: SLC7A5-ANP32A | Fusion gene ID: 82903 | Hgene | Tgene | Gene symbol | SLC7A5 | ANP32A | Gene ID | 8140 | 8125 |
Gene name | solute carrier family 7 member 5 | acidic nuclear phosphoprotein 32 family member A | |
Synonyms | 4F2LC|CD98|D16S469E|E16|LAT1|MPE16 | C15orf1|HPPCn|I1PP2A|LANP|MAPM|PHAP1|PHAPI|PP32 | |
Cytomap | 16q24.2 | 15q23 | |
Type of gene | protein-coding | protein-coding | |
Description | large neutral amino acids transporter small subunit 14F2 light chainCD98 light chainL-type amino acid transporter 1integral membrane protein E16sodium-independent neutral amino acid transporter LAT1solute carrier family 7 (amino acid transporter lig | acidic leucine-rich nuclear phosphoprotein 32 family member Aacidic (leucine-rich) nuclear phosphoprotein 32 family, member Aacidic nuclear phosphoprotein pp32cerebellar leucine rich acidic nuclear proteinepididymis secretory sperm binding proteinhep | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | . | P39687 | |
Ensembl transtripts involved in fusion gene | ENST00000565644, ENST00000261622, | ENST00000465139, ENST00000483551, ENST00000560303, | |
Fusion gene scores | * DoF score | 17 X 9 X 10=1530 | 3 X 3 X 3=27 |
# samples | 20 | 3 | |
** MAII score | log2(20/1530*10)=-2.93545974780529 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(3/27*10)=0.15200309344505 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
Context | PubMed: SLC7A5 [Title/Abstract] AND ANP32A [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | SLC7A5(87902491)-ANP32A(69080258), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | SLC7A5 | GO:1904556 | L-tryptophan transmembrane transport | 30867591 |
Tgene | ANP32A | GO:0006913 | nucleocytoplasmic transport | 11729309 |
Fusion gene breakpoints across SLC7A5 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across ANP32A (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-CG-5721-01A | SLC7A5 | chr16 | 87902491 | - | ANP32A | chr15 | 69080258 | - |
Top |
Fusion Gene ORF analysis for SLC7A5-ANP32A |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
intron-3CDS | ENST00000565644 | ENST00000465139 | SLC7A5 | chr16 | 87902491 | - | ANP32A | chr15 | 69080258 | - |
intron-5UTR | ENST00000565644 | ENST00000483551 | SLC7A5 | chr16 | 87902491 | - | ANP32A | chr15 | 69080258 | - |
intron-5UTR | ENST00000565644 | ENST00000560303 | SLC7A5 | chr16 | 87902491 | - | ANP32A | chr15 | 69080258 | - |
In-frame | ENST00000261622 | ENST00000465139 | SLC7A5 | chr16 | 87902491 | - | ANP32A | chr15 | 69080258 | - |
5CDS-5UTR | ENST00000261622 | ENST00000483551 | SLC7A5 | chr16 | 87902491 | - | ANP32A | chr15 | 69080258 | - |
5CDS-5UTR | ENST00000261622 | ENST00000560303 | SLC7A5 | chr16 | 87902491 | - | ANP32A | chr15 | 69080258 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000261622 | SLC7A5 | chr16 | 87902491 | - | ENST00000465139 | ANP32A | chr15 | 69080258 | - | 2846 | 604 | 619 | 1299 | 226 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000261622 | ENST00000465139 | SLC7A5 | chr16 | 87902491 | - | ANP32A | chr15 | 69080258 | - | 0.000899422 | 0.99910057 |
Top |
Fusion Genomic Features for SLC7A5-ANP32A |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for SLC7A5-ANP32A |
Go to FGviewer for the breakpoints of chr16:87902491-chr15:69080258 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
. | ANP32A |
FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: Multifunctional protein that is involved in the regulation of many processes including tumor suppression, apoptosis, cell cycle progression or transcription (PubMed:16341127, PubMed:11360199, PubMed:18439902, PubMed:10400610). Promotes apoptosis by favouring the activation of caspase-9/CASP9 and allowing apoptosome formation (PubMed:18439902). In addition, plays a role in the modulation of histone acetylation and transcription as part of the INHAT (inhibitor of histone acetyltransferases) complex. Inhibits the histone-acetyltranferase activity of EP300/CREBBP (CREB-binding protein) and EP300/CREBBP-associated factor by histone masking (PubMed:11830591). Preferentially binds to unmodified histone H3 and sterically inhibiting its acetylation and phosphorylation leading to cell growth inhibition (PubMed:16341127). Participates in other biochemical processes such as regulation of mRNA nuclear-to-cytoplasmic translocation and stability by its association with ELAVL1 (Hu-antigen R) (PubMed:18180367). Plays a role in E4F1-mediated transcriptional repression as well as inhibition of protein phosphatase 2A (PubMed:15642345, PubMed:17557114). {ECO:0000269|PubMed:10400610, ECO:0000269|PubMed:11360199, ECO:0000269|PubMed:11830591, ECO:0000269|PubMed:15642345, ECO:0000269|PubMed:16341127, ECO:0000269|PubMed:17557114, ECO:0000269|PubMed:18180367, ECO:0000269|PubMed:18439902}.; FUNCTION: (Microbial infection) Plays an essential role in influenza A, B and C viral genome replication (PubMed:32694517, PubMed:33045004, PubMed:33208942, PubMed:30666459). Mechanistically, mediates the assembly of the viral replicase asymmetric dimers composed of PB1, PB2 and PA via its N-terminal region (PubMed:33208942). Plays also an essential role in foamy virus mRNA export from the nucleus (PubMed:21159877). {ECO:0000269|PubMed:21159877, ECO:0000269|PubMed:30666459, ECO:0000269|PubMed:32694517, ECO:0000269|PubMed:33045004, ECO:0000269|PubMed:33208942}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 105_126 | 179.33333333333334 | 508.0 | Topological domain | Cytoplasmic |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 148_169 | 179.33333333333334 | 508.0 | Topological domain | Extracellular |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 1_49 | 179.33333333333334 | 508.0 | Topological domain | Cytoplasmic |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 71_83 | 179.33333333333334 | 508.0 | Topological domain | Extracellular |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 127_147 | 179.33333333333334 | 508.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 50_70 | 179.33333333333334 | 508.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 84_104 | 179.33333333333334 | 508.0 | Transmembrane | Helical |
Tgene | ANP32A | chr16:87902491 | chr15:69080258 | ENST00000465139 | 0 | 7 | 168_249 | 18.0 | 250.0 | Compositional bias | Note=Asp/Glu-rich (highly acidic) | |
Tgene | ANP32A | chr16:87902491 | chr15:69080258 | ENST00000465139 | 0 | 7 | 123_161 | 18.0 | 250.0 | Domain | Note=LRRCT | |
Tgene | ANP32A | chr16:87902491 | chr15:69080258 | ENST00000465139 | 0 | 7 | 150_174 | 18.0 | 250.0 | Region | Note=Necessary for tumor-suppressive function | |
Tgene | ANP32A | chr16:87902491 | chr15:69080258 | ENST00000465139 | 0 | 7 | 18_38 | 18.0 | 250.0 | Repeat | LRR 1 | |
Tgene | ANP32A | chr16:87902491 | chr15:69080258 | ENST00000465139 | 0 | 7 | 43_64 | 18.0 | 250.0 | Repeat | LRR 2 | |
Tgene | ANP32A | chr16:87902491 | chr15:69080258 | ENST00000465139 | 0 | 7 | 65_87 | 18.0 | 250.0 | Repeat | LRR 3 | |
Tgene | ANP32A | chr16:87902491 | chr15:69080258 | ENST00000465139 | 0 | 7 | 89_110 | 18.0 | 250.0 | Repeat | LRR 4 |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 191_192 | 179.33333333333334 | 508.0 | Topological domain | Cytoplasmic |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 215_242 | 179.33333333333334 | 508.0 | Topological domain | Extracellular |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 264_276 | 179.33333333333334 | 508.0 | Topological domain | Cytoplasmic |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 298_324 | 179.33333333333334 | 508.0 | Topological domain | Extracellular |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 346_369 | 179.33333333333334 | 508.0 | Topological domain | Cytoplasmic |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 391_395 | 179.33333333333334 | 508.0 | Topological domain | Extracellular |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 417_430 | 179.33333333333334 | 508.0 | Topological domain | Cytoplasmic |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 452_457 | 179.33333333333334 | 508.0 | Topological domain | Extracellular |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 479_507 | 179.33333333333334 | 508.0 | Topological domain | Cytoplasmic |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 105_126 | 0 | 242.0 | Topological domain | Cytoplasmic |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 148_169 | 0 | 242.0 | Topological domain | Extracellular |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 191_192 | 0 | 242.0 | Topological domain | Cytoplasmic |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 1_49 | 0 | 242.0 | Topological domain | Cytoplasmic |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 215_242 | 0 | 242.0 | Topological domain | Extracellular |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 264_276 | 0 | 242.0 | Topological domain | Cytoplasmic |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 298_324 | 0 | 242.0 | Topological domain | Extracellular |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 346_369 | 0 | 242.0 | Topological domain | Cytoplasmic |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 391_395 | 0 | 242.0 | Topological domain | Extracellular |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 417_430 | 0 | 242.0 | Topological domain | Cytoplasmic |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 452_457 | 0 | 242.0 | Topological domain | Extracellular |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 479_507 | 0 | 242.0 | Topological domain | Cytoplasmic |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 71_83 | 0 | 242.0 | Topological domain | Extracellular |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 170_190 | 179.33333333333334 | 508.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 193_214 | 179.33333333333334 | 508.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 243_263 | 179.33333333333334 | 508.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 277_297 | 179.33333333333334 | 508.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 325_345 | 179.33333333333334 | 508.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 370_390 | 179.33333333333334 | 508.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 396_416 | 179.33333333333334 | 508.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 431_451 | 179.33333333333334 | 508.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000261622 | - | 1 | 10 | 458_478 | 179.33333333333334 | 508.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 127_147 | 0 | 242.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 170_190 | 0 | 242.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 193_214 | 0 | 242.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 243_263 | 0 | 242.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 277_297 | 0 | 242.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 325_345 | 0 | 242.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 370_390 | 0 | 242.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 396_416 | 0 | 242.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 431_451 | 0 | 242.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 458_478 | 0 | 242.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 50_70 | 0 | 242.0 | Transmembrane | Helical |
Hgene | SLC7A5 | chr16:87902491 | chr15:69080258 | ENST00000565644 | - | 1 | 10 | 84_104 | 0 | 242.0 | Transmembrane | Helical |
Top |
Fusion Gene Sequence for SLC7A5-ANP32A |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>In-frame_ENST00000261622_ENST00000465139_TCGA-CG-5721-01A_SLC7A5_chr16_87902491_-_ANP32A_chr15_69080258_length(transcript)=2846nt_BP=604nt GCGGCGCGCACACTGCTCGCTGGGCCGCGGCTCCCGGGTGTCCCAGGCCCGGCCGGTGCGCAGAGCATGGCGGGTGCGGGCCCGAAGCGG CGCGCGCTAGCGGCGCCGGCGGCCGAGGAGAAGGAAGAGGCGCGGGAGAAGATGCTGGCCGCCAAGAGCGCGGACGGCTCGGCGCCGGCA GGCGAGGGCGAGGGCGTGACCCTGCAGCGGAACATCACGCTGCTCAACGGCGTGGCCATCATCGTGGGGACCATTATCGGCTCGGGCATC TTCGTGACGCCCACGGGCGTGCTCAAGGAGGCAGGCTCGCCGGGGCTGGCGCTGGTGGTGTGGGCCGCGTGCGGCGTCTTCTCCATCGTG GGCGCGCTCTGCTACGCGGAGCTCGGCACCACCATCTCCAAATCGGGCGGCGACTACGCCTACATGCTGGAGGTCTACGGCTCGCTGCCC GCCTTCCTCAAGCTCTGGATCGAGCTGCTCATCATCCGGCCTTCATCGCAGTACATCGTGGCCCTGGTCTTCGCCACCTACCTGCTCAAG CCGCTCTTCCCCACCTGCCCGGTGCCCGAGGAGGCAGCCAAGCTCGTGGCCTGCCTCTGCGTGCGTGAAAGAACTTGTCCTGGACAACAG TCGGTCGAATGAAGGCAAACTCGAAGGCCTCACAGATGAATTTGAAGAACTGGAATTCTTAAGTACAATCAACGTAGGCCTCACCTCAAT CGCAAACTTACCAAAGTTAAACAAACTTAAGAAGCTTGAACTAAGCGATAACAGAGTCTCAGGGGGCCTGGAAGTATTGGCAGAAAAGTG TCCGAACCTCACGCATCTAAATTTAAGTGGCAACAAAATTAAAGACCTCAGCACAATAGAGCCACTGAAAAAGTTAGAAAACCTCAAGAG CTTAGACCTTTTCAATTGCGAGGTAACCAACCTGAACGACTACCGAGAAAATGTGTTCAAGCTCCTCCCGCAACTCACATATCTCGACGG CTATGACCGGGACGACAAGGAGGCCCCTGACTCGGATGCTGAGGGCTACGTGGAGGGCCTGGATGATGAGGAGGAGGATGAGGATGAGGA GGAGTATGATGAAGATGCTCAGGTAGTGGAAGACGAGGAGGACGAGGATGAGGAGGAGGAAGGTGAAGAGGAGGACGTGAGTGGAGAGGA GGAGGAGGATGAAGAAGGTTATAACGATGGAGAGGTAGATGACGAGGAAGATGAAGAAGAGCTTGGTGAAGAAGAAAGGGGTCAGAAGCG AAAACGAGAACCTGAAGATGAGGGAGAAGATGATGACTAAGTGGAATAACCTATTTTGAAAAATTCCTATTGTGATTTGACTGTTTTTAC CCATATCCCCTCTCCCCCCCCCCTCCAATCCTGCCCCCTGAAACTTATTTTTTTCTGATTGTAACGTTGCTGTGGGAACGAGAGGGGAAG AGTGTACTGGGGGTTGCGGGGGGAGGGATGGCGGGTGGGGGTGGAATAAAATACTATTTTTACTGCCACTCTTTATTTTTTTCCCCTACT TTTTCTTTGTGTCCGGTTTTTGTCCCTGTAAATGCGATAGCTAAGTACACACTAAGTGAGCATTTGTTCCTGACTCTCAAAGAGGATGGT TTGGAGTTCTCTTACGTTTCCTGGTATTTCCCAAGTCTCTTGGGTTGGTTGGAAGGCTGTGGCTGGTCTCAGTTTGGTTACTCAATGCCC AGGAGGGGCTGAGCACCAGCCATATCTTTTGCTTTGGTTCACATGATGATACCTGCTTTTCTCAGGCCTGCTAGAGGCATCCAACGCCCT GGTTTGTAAATAGCAACCTAAAGGCGTATTTTGGCACTGGTCTGGGGACATTCCCCATCTCTCATCCCTTTTCCCCCTTCACAGATGGTG GTGGGCTTCGCTCTACAAAGAGGACTCTGATGTTACTCTTGAGCTTATGAGCCAGAGAGCTGAAAACCGCAGGCTTGTTGTGTTAAGTTA CAAGGAAAATGGATTTGGTAATTAAAATTAGAAGAAACACACCTTCAAACTTCAACTTCTTTAAAAGAAAAAAAAAACTGTCCTATCTTG TTCTGTAAAATATTAGAACGCTTTGTTTTACAAAAAATGATGAGAGAATTCTTCCACATGTACTTCTGTGCTTAGAACATTTTTACGGAC CTAAGCGCTGGAGACGTTGCTGCATGTCGGCTGGGTTTTTTTTTTCATACACCCGAGCACGGAAAAACTAACGCAAAATTGTATTTTCTT ACCTAGTGGAAATCTGAAATGACTGCAAATTCCTAGTGAATGTACAGGTTTGCTTTCGTGTCCCTCTTCTGGTTGCTTTAGAAGTGACGT GTAATTTCTGAACCCATGTTTCATCTGTATAAAAGAACATCTGCACCAGTTTTTCTCCTGCCCCTCAGAAGAGCCAAACTTTGAGTTTTA TGTCTGTTTGTCATTGATAAATTTCAATAAATCTTTTTATACAATTTTTTTGGGGATGGCTTCTTTGAGTCCAACAGGCCATTGATCTTT TCAAGATGCATTCCAGATGAACTGCTAGGTGAGGGGGAAGCTTCATTTTTGTTACCTGATAGAATAGCTTTTCTTATGAGATATATATAA TGTGATACTATGTTTGGATATTTTTGGTCTTAAAGCAAGACTCAGTGGTGTATCTTCATTAAAAGCTTCCTTTAAAAAAGTTACAGAGTT ACTAAAAAAACAAGTACCCAAACAATCAAGTTGGGCCAACCTTGGAACCTTGTTTTGAATATCTTTCATTGTTTTGTTTGTCGTATTGTA >In-frame_ENST00000261622_ENST00000465139_TCGA-CG-5721-01A_SLC7A5_chr16_87902491_-_ANP32A_chr15_69080258_length(amino acids)=226AA_start in transcript=619_stop in transcript=1299 MDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLE NLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDV -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for SLC7A5-ANP32A |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
Tgene | ANP32A | chr16:87902491 | chr15:69080258 | ENST00000465139 | 0 | 7 | 165_249 | 18.0 | 250.0 | E4F1 |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for SLC7A5-ANP32A |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for SLC7A5-ANP32A |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | SLC7A5 | C0024121 | Lung Neoplasms | 1 | CTD_human |
Hgene | SLC7A5 | C0162820 | Dermatitis, Allergic Contact | 1 | CTD_human |
Hgene | SLC7A5 | C0242379 | Malignant neoplasm of lung | 1 | CTD_human |
Tgene | ANP32A | C0009402 | Colorectal Carcinoma | 1 | CTD_human |
Tgene | ANP32A | C0009404 | Colorectal Neoplasms | 1 | CTD_human |
Tgene | ANP32A | C0152013 | Adenocarcinoma of lung (disorder) | 1 | CTD_human |