|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:SMC5-CDKN2A (FusionGDB2 ID:83428) |
Fusion Gene Summary for SMC5-CDKN2A |
Fusion gene summary |
Fusion gene information | Fusion gene name: SMC5-CDKN2A | Fusion gene ID: 83428 | Hgene | Tgene | Gene symbol | SMC5 | CDKN2A | Gene ID | 23137 | 1029 |
Gene name | structural maintenance of chromosomes 5 | cyclin dependent kinase inhibitor 2A | |
Synonyms | SMC5L1 | ARF|CDK4I|CDKN2|CMM2|INK4|INK4A|MLM|MTS-1|MTS1|P14|P14ARF|P16|P16-INK4A|P16INK4|P16INK4A|P19|P19ARF|TP16 | |
Cytomap | 9q21.12 | 9p21.3 | |
Type of gene | protein-coding | protein-coding | |
Description | structural maintenance of chromosomes protein 5SMC protein 5SMC-5SMC5 structural maintenance of chromosomes 5-like 1hSMC5 | cyclin-dependent kinase inhibitor 2ACDK4 inhibitor p16-INK4alternative reading framecell cycle negative regulator betacyclin-dependent kinase 4 inhibitor Acyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4)multiple tumor suppressor 1 | |
Modification date | 20200313 | 20200329 | |
UniProtAcc | . | Q96HQ2 | |
Ensembl transtripts involved in fusion gene | ENST00000361138, ENST00000471372, | ENST00000361570, ENST00000304494, ENST00000579755, ENST00000579122, ENST00000578845, ENST00000530628, ENST00000498124, ENST00000498628, ENST00000494262, ENST00000446177, ENST00000479692, ENST00000497750, ENST00000470819, | |
Fusion gene scores | * DoF score | 8 X 10 X 4=320 | 13 X 5 X 10=650 |
# samples | 9 | 16 | |
** MAII score | log2(9/320*10)=-1.83007499855769 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(16/650*10)=-2.02236781302845 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: SMC5 [Title/Abstract] AND CDKN2A [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | SMC5(72879361)-CDKN2A(21971207), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | SMC5-CDKN2A seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. SMC5-CDKN2A seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. SMC5-CDKN2A seems lost the major protein functional domain in Tgene partner, which is a tumor suppressor due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | SMC5 | GO:0006974 | cellular response to DNA damage stimulus | 11408570|25931565 |
Tgene | CDKN2A | GO:0000082 | G1/S transition of mitotic cell cycle | 10208428 |
Tgene | CDKN2A | GO:0007050 | cell cycle arrest | 15149599 |
Tgene | CDKN2A | GO:0008285 | negative regulation of cell proliferation | 15149599 |
Tgene | CDKN2A | GO:0030308 | negative regulation of cell growth | 10208428 |
Tgene | CDKN2A | GO:0032088 | negative regulation of NF-kappaB transcription factor activity | 10353611 |
Tgene | CDKN2A | GO:0042326 | negative regulation of phosphorylation | 8259215|10208428 |
Tgene | CDKN2A | GO:0045736 | negative regulation of cyclin-dependent protein serine/threonine kinase activity | 7739547|8259215 |
Fusion gene breakpoints across SMC5 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across CDKN2A (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | OV | TCGA-13-0725 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
Top |
Fusion Gene ORF analysis for SMC5-CDKN2A |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
Frame-shift | ENST00000361138 | ENST00000361570 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
In-frame | ENST00000361138 | ENST00000304494 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
Frame-shift | ENST00000361138 | ENST00000579755 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
In-frame | ENST00000361138 | ENST00000579122 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
5CDS-5UTR | ENST00000361138 | ENST00000578845 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
5CDS-5UTR | ENST00000361138 | ENST00000530628 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
5CDS-5UTR | ENST00000361138 | ENST00000498124 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
5CDS-5UTR | ENST00000361138 | ENST00000498628 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
5CDS-5UTR | ENST00000361138 | ENST00000494262 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
5CDS-5UTR | ENST00000361138 | ENST00000446177 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
5CDS-5UTR | ENST00000361138 | ENST00000479692 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
5CDS-5UTR | ENST00000361138 | ENST00000497750 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
5CDS-intron | ENST00000361138 | ENST00000470819 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
intron-3CDS | ENST00000471372 | ENST00000361570 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
intron-3CDS | ENST00000471372 | ENST00000304494 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
intron-3CDS | ENST00000471372 | ENST00000579755 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
intron-3CDS | ENST00000471372 | ENST00000579122 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
intron-5UTR | ENST00000471372 | ENST00000578845 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
intron-5UTR | ENST00000471372 | ENST00000530628 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
intron-5UTR | ENST00000471372 | ENST00000498124 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
intron-5UTR | ENST00000471372 | ENST00000498628 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
intron-5UTR | ENST00000471372 | ENST00000494262 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
intron-5UTR | ENST00000471372 | ENST00000446177 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
intron-5UTR | ENST00000471372 | ENST00000479692 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
intron-5UTR | ENST00000471372 | ENST00000497750 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
intron-intron | ENST00000471372 | ENST00000470819 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000361138 | SMC5 | chr9 | 72879361 | + | ENST00000304494 | CDKN2A | chr9 | 21971207 | - | 1182 | 385 | 695 | 0 | 232 |
ENST00000361138 | SMC5 | chr9 | 72879361 | + | ENST00000579122 | CDKN2A | chr9 | 21971207 | - | 870 | 385 | 34 | 651 | 205 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000361138 | ENST00000304494 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - | 0.13600259 | 0.8639974 |
ENST00000361138 | ENST00000579122 | SMC5 | chr9 | 72879361 | + | CDKN2A | chr9 | 21971207 | - | 0.41567847 | 0.58432156 |
Top |
Fusion Genomic Features for SMC5-CDKN2A |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for SMC5-CDKN2A |
Go to FGviewer for the breakpoints of chr9:72879361-chr9:21971207 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
. | CDKN2A |
FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | SMC5 | chr9:72879361 | chr9:21971207 | ENST00000361138 | + | 2 | 25 | 80_87 | 109.0 | 1102.0 | Nucleotide binding | ATP |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000304494 | 0 | 3 | 110_139 | 50.0 | 157.0 | Repeat | Note=ANK 4 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000304494 | 0 | 3 | 77_106 | 50.0 | 157.0 | Repeat | Note=ANK 3 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000446177 | 0 | 3 | 110_139 | 50.0 | 168.0 | Repeat | Note=ANK 4 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000446177 | 0 | 3 | 77_106 | 50.0 | 168.0 | Repeat | Note=ANK 3 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000494262 | 1 | 4 | 110_139 | 0 | 106.0 | Repeat | Note=ANK 4 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000494262 | 1 | 4 | 11_40 | 0 | 106.0 | Repeat | Note=ANK 1 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000494262 | 1 | 4 | 44_72 | 0 | 106.0 | Repeat | Note=ANK 2 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000494262 | 1 | 4 | 77_106 | 0 | 106.0 | Repeat | Note=ANK 3 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000498124 | 0 | 4 | 110_139 | 50.0 | 130.66666666666666 | Repeat | Note=ANK 4 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000498124 | 0 | 4 | 77_106 | 50.0 | 130.66666666666666 | Repeat | Note=ANK 3 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000498628 | 0 | 3 | 110_139 | 0 | 106.0 | Repeat | Note=ANK 4 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000498628 | 0 | 3 | 11_40 | 0 | 106.0 | Repeat | Note=ANK 1 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000498628 | 0 | 3 | 44_72 | 0 | 106.0 | Repeat | Note=ANK 2 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000498628 | 0 | 3 | 77_106 | 0 | 106.0 | Repeat | Note=ANK 3 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000578845 | 0 | 2 | 110_139 | 0 | 106.0 | Repeat | Note=ANK 4 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000578845 | 0 | 2 | 11_40 | 0 | 106.0 | Repeat | Note=ANK 1 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000578845 | 0 | 2 | 44_72 | 0 | 106.0 | Repeat | Note=ANK 2 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000578845 | 0 | 2 | 77_106 | 0 | 106.0 | Repeat | Note=ANK 3 |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | SMC5 | chr9:72879361 | chr9:21971207 | ENST00000361138 | + | 2 | 25 | 207_445 | 109.0 | 1102.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | SMC5 | chr9:72879361 | chr9:21971207 | ENST00000361138 | + | 2 | 25 | 647_828 | 109.0 | 1102.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | SMC5 | chr9:72879361 | chr9:21971207 | ENST00000361138 | + | 2 | 25 | 888_927 | 109.0 | 1102.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | SMC5 | chr9:72879361 | chr9:21971207 | ENST00000361138 | + | 2 | 25 | 991_1026 | 109.0 | 1102.0 | Compositional bias | Note=Ala/Asp-rich (DA-box) |
Hgene | SMC5 | chr9:72879361 | chr9:21971207 | ENST00000361138 | + | 2 | 25 | 446_646 | 109.0 | 1102.0 | Region | Note=Flexible hinge |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000304494 | 0 | 3 | 11_40 | 50.0 | 157.0 | Repeat | Note=ANK 1 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000304494 | 0 | 3 | 44_72 | 50.0 | 157.0 | Repeat | Note=ANK 2 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000446177 | 0 | 3 | 11_40 | 50.0 | 168.0 | Repeat | Note=ANK 1 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000446177 | 0 | 3 | 44_72 | 50.0 | 168.0 | Repeat | Note=ANK 2 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000498124 | 0 | 4 | 11_40 | 50.0 | 130.66666666666666 | Repeat | Note=ANK 1 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000498124 | 0 | 4 | 44_72 | 50.0 | 130.66666666666666 | Repeat | Note=ANK 2 |
Top |
Fusion Gene Sequence for SMC5-CDKN2A |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>In-frame_ENST00000361138_ENST00000304494_TCGA-13-0725_SMC5_chr9_72879361_+_CDKN2A_chr9_21971207_length(transcript)=1182nt_BP=385nt CGCCTGGGCTGCCGGACGGTGGGAACGGAAGTCGCTGTGGGACGCTGAGGAAGCCAGGATGGCGACTCCGAGCAAGAAGACGTCAACTCC AAGCCCCCAGCCTTCCAAGAGAGCTCTCCCGAGAGACCCTTCGTCGGAGGTCCCGAGCAAGAGGAAGAATTCGGCCCCGCAGCTGCCGCT GTTGCAGTCGTCCGGGCCTTTCGTGGAAGGCTCTATCGTCCGCATCTCGATGGAGAACTTCCTAACATATGATATTTGTGAAGTATCTCC TGGACCCCACTTGAATATGATCGTTGGAGCCAATGGAACAGGGAAGTCGAGCATTGTGTGTGCCATTTGCCTTGGTTTAGCTGGAAAACC TGCTTTCATGGGACGAGCAGATAAGGTCATGATGATGGGCAGCGCCCGAGTGGCGGAGCTGCTGCTGCTCCACGGCGCGGAGCCCAACTG CGCCGACCCCGCCACTCTCACCCGACCCGTGCACGACGCTGCCCGGGAGGGCTTCCTGGACACGCTGGTGGTGCTGCACCGGGCCGGGGC GCGGCTGGACGTGCGCGATGCCTGGGGCCGTCTGCCCGTGGACCTGGCTGAGGAGCTGGGCCATCGCGATGTCGCACGGTACCTGCGCGC GGCTGCGGGGGGCACCAGAGGCAGTAACCATGCCCGCATAGATGCCGCGGAAGGTCCCTCAGACATCCCCGATTGAAAGAACCAGAGAGG CTCTGAGAAACCTCGGGAAACTTAGATCATCAGTCACCGAAGGTCCTACAGGGCCACAACTGCCCCCGCCACAACCCACCCCGCTTTCGT AGTTTTCATTTAGAAAATAGAGCTTTTAAAAATGTCCTGCCTTTTAACGTAGATATATGCCTTCCCCCACTACCGTAAATGTCCATTTAT ATCATTTTTTATATATTCTTATAAAAATGTAAAAAAGAAAAACACCGCTTCTGCCTTTTCACTGTGTTGGAGTTTTCTGGAGTGAGCACT CACGCCCTAAGCGCACATTCATGTGGGCATTTCTTGCGAGCCTCGCAGCCTCCGGAAGCTGTCGACTTCATGACAAGCATTTTGTGAACT AGGGAAGCTCAGGGGGGTTACTGGCTTCTCTTGAGTCACACTGCTAGCAAATGGCAGAACCAAAGCTCAAATAAAAATAAAATAATTTTC >In-frame_ENST00000361138_ENST00000304494_TCGA-13-0725_SMC5_chr9_72879361_+_CDKN2A_chr9_21971207_length(amino acids)=232AA_start in transcript=695_stop in transcript=0 MSEGPSAASMRAWLLPLVPPAAARRYRATSRWPSSSARSTGRRPQASRTSSRAPARCSTTSVSRKPSRAASCTGRVRVAGSAQLGSAPWS SSSSATRALPIIMTLSARPMKAGFPAKPRQMAHTMLDFPVPLAPTIIFKWGPGDTSQISYVRKFSIEMRTIEPSTKGPDDCNSGSCGAEF -------------------------------------------------------------- >In-frame_ENST00000361138_ENST00000579122_TCGA-13-0725_SMC5_chr9_72879361_+_CDKN2A_chr9_21971207_length(transcript)=870nt_BP=385nt CGCCTGGGCTGCCGGACGGTGGGAACGGAAGTCGCTGTGGGACGCTGAGGAAGCCAGGATGGCGACTCCGAGCAAGAAGACGTCAACTCC AAGCCCCCAGCCTTCCAAGAGAGCTCTCCCGAGAGACCCTTCGTCGGAGGTCCCGAGCAAGAGGAAGAATTCGGCCCCGCAGCTGCCGCT GTTGCAGTCGTCCGGGCCTTTCGTGGAAGGCTCTATCGTCCGCATCTCGATGGAGAACTTCCTAACATATGATATTTGTGAAGTATCTCC TGGACCCCACTTGAATATGATCGTTGGAGCCAATGGAACAGGGAAGTCGAGCATTGTGTGTGCCATTTGCCTTGGTTTAGCTGGAAAACC TGCTTTCATGGGACGAGCAGATAAGGTCATGATGATGGGCAGCGCCCGAGTGGCGGAGCTGCTGCTGCTCCACGGCGCGGAGCCCAACTG CGCCGACCCCGCCACTCTCACCCGACCCGTGCACGACGCTGCCCGGGAGGGCTTCCTGGACACGCTGGTGGTGCTGCACCGGGCCGGGGC GCGGCTGGACGTGCGCGATGCCTGGGGCCGTCTGCCCGTGGACCTGGCTGAGGAGCTGGGCCATCGCGATGTCGCACGACATCCCCGATT GAAAGAACCAGAGAGGCTCTGAGAAACCTCGGGAAACTTAGATCATCAGTCACCGAAGGTCCTACAGGGCCACAACTGCCCCCGCCACAA CCCACCCCGCTTTCGTAGTTTTCATTTAGAAAATAGAGCTTTTAAAAATGTCCTGCCTTTTAACGTAGATATATGCCTTCCCCCACTACC >In-frame_ENST00000361138_ENST00000579122_TCGA-13-0725_SMC5_chr9_72879361_+_CDKN2A_chr9_21971207_length(amino acids)=205AA_start in transcript=34_stop in transcript=651 MWDAEEARMATPSKKTSTPSPQPSKRALPRDPSSEVPSKRKNSAPQLPLLQSSGPFVEGSIVRISMENFLTYDICEVSPGPHLNMIVGAN GTGKSSIVCAICLGLAGKPAFMGRADKVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRL -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for SMC5-CDKN2A |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000361570 | 0 | 3 | 1_64 | 105.33333333333333 | 220.0 | CDK5RAP3 and MDM2 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000530628 | 0 | 3 | 1_64 | 64.33333333333333 | 122.66666666666667 | CDK5RAP3 and MDM2 | |
Tgene | CDKN2A | chr9:72879361 | chr9:21971207 | ENST00000579755 | 0 | 3 | 1_64 | 64.33333333333333 | 134.33333333333334 | CDK5RAP3 and MDM2 |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for SMC5-CDKN2A |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for SMC5-CDKN2A |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | SMC5 | C0023893 | Liver Cirrhosis, Experimental | 1 | CTD_human |
Tgene | CDKN2A | C1835044 | MELANOMA, CUTANEOUS MALIGNANT, SUSCEPTIBILITY TO, 2 | 13 | CTD_human;GENOMICS_ENGLAND;UNIPROT |
Tgene | CDKN2A | C1838547 | MELANOMA-PANCREATIC CANCER SYNDROME | 10 | CLINGEN;CTD_human |
Tgene | CDKN2A | C0024121 | Lung Neoplasms | 4 | CTD_human;UNIPROT |
Tgene | CDKN2A | C0242379 | Malignant neoplasm of lung | 4 | CTD_human |
Tgene | CDKN2A | C0011570 | Mental Depression | 3 | PSYGENET |
Tgene | CDKN2A | C0011581 | Depressive disorder | 3 | PSYGENET |
Tgene | CDKN2A | C0023903 | Liver neoplasms | 3 | CTD_human |
Tgene | CDKN2A | C0345904 | Malignant neoplasm of liver | 3 | CTD_human |
Tgene | CDKN2A | C0345967 | Malignant mesothelioma | 3 | CTD_human |
Tgene | CDKN2A | C1168401 | Squamous cell carcinoma of the head and neck | 3 | CTD_human |
Tgene | CDKN2A | C0005684 | Malignant neoplasm of urinary bladder | 2 | CTD_human |
Tgene | CDKN2A | C0005695 | Bladder Neoplasm | 2 | CTD_human;UNIPROT |
Tgene | CDKN2A | C0006118 | Brain Neoplasms | 2 | CTD_human |
Tgene | CDKN2A | C0006826 | Malignant Neoplasms | 2 | CGI;CTD_human |
Tgene | CDKN2A | C0007131 | Non-Small Cell Lung Carcinoma | 2 | CTD_human;UNIPROT |
Tgene | CDKN2A | C0017638 | Glioma | 2 | CGI;CTD_human |
Tgene | CDKN2A | C0023452 | Childhood Acute Lymphoblastic Leukemia | 2 | CTD_human;GENOMICS_ENGLAND |
Tgene | CDKN2A | C0025202 | melanoma | 2 | CGI;CTD_human;GENOMICS_ENGLAND;UNIPROT |
Tgene | CDKN2A | C0027651 | Neoplasms | 2 | CTD_human |
Tgene | CDKN2A | C0030297 | Pancreatic Neoplasm | 2 | CGI;CTD_human;UNIPROT |
Tgene | CDKN2A | C0040715 | Chromosomal translocation | 2 | CTD_human |
Tgene | CDKN2A | C0041696 | Unipolar Depression | 2 | PSYGENET |
Tgene | CDKN2A | C0085390 | Li-Fraumeni Syndrome | 2 | ORPHANET |
Tgene | CDKN2A | C0086692 | Benign Neoplasm | 2 | CTD_human |
Tgene | CDKN2A | C0153633 | Malignant neoplasm of brain | 2 | CTD_human |
Tgene | CDKN2A | C0259783 | mixed gliomas | 2 | CTD_human |
Tgene | CDKN2A | C0346647 | Malignant neoplasm of pancreas | 2 | CGI;CTD_human |
Tgene | CDKN2A | C0496899 | Benign neoplasm of brain, unspecified | 2 | CTD_human |
Tgene | CDKN2A | C0555198 | Malignant Glioma | 2 | CTD_human |
Tgene | CDKN2A | C0750974 | Brain Tumor, Primary | 2 | CTD_human |
Tgene | CDKN2A | C0750977 | Recurrent Brain Neoplasm | 2 | CTD_human |
Tgene | CDKN2A | C0750979 | Primary malignant neoplasm of brain | 2 | CTD_human |
Tgene | CDKN2A | C1269683 | Major Depressive Disorder | 2 | PSYGENET |
Tgene | CDKN2A | C1527390 | Neoplasms, Intracranial | 2 | CTD_human |
Tgene | CDKN2A | C2239176 | Liver carcinoma | 2 | CTD_human |
Tgene | CDKN2A | C0001418 | Adenocarcinoma | 1 | CTD_human |
Tgene | CDKN2A | C0001624 | Adrenal Gland Neoplasms | 1 | CTD_human |
Tgene | CDKN2A | C0005940 | Bone Diseases | 1 | CTD_human |
Tgene | CDKN2A | C0006142 | Malignant neoplasm of breast | 1 | CTD_human |
Tgene | CDKN2A | C0006413 | Burkitt Lymphoma | 1 | ORPHANET |
Tgene | CDKN2A | C0007137 | Squamous cell carcinoma | 1 | CTD_human;UNIPROT |
Tgene | CDKN2A | C0008628 | Chromosome Deletion | 1 | CTD_human |
Tgene | CDKN2A | C0014859 | Esophageal Neoplasms | 1 | CTD_human;UNIPROT |
Tgene | CDKN2A | C0016325 | Fluoride Poisoning | 1 | CTD_human |
Tgene | CDKN2A | C0017601 | Glaucoma | 1 | CTD_human |
Tgene | CDKN2A | C0022783 | Vulvar Lichen Sclerosus | 1 | CTD_human |
Tgene | CDKN2A | C0023449 | Acute lymphocytic leukemia | 1 | GENOMICS_ENGLAND |
Tgene | CDKN2A | C0023453 | L2 Acute Lymphoblastic Leukemia | 1 | CTD_human |
Tgene | CDKN2A | C0024232 | Lymphatic Metastasis | 1 | CTD_human |
Tgene | CDKN2A | C0024299 | Lymphoma | 1 | CTD_human |
Tgene | CDKN2A | C0024623 | Malignant neoplasm of stomach | 1 | CTD_human |
Tgene | CDKN2A | C0025500 | Mesothelioma | 1 | CTD_human |
Tgene | CDKN2A | C0026640 | Mouth Neoplasms | 1 | CTD_human |
Tgene | CDKN2A | C0026764 | Multiple Myeloma | 1 | CTD_human |
Tgene | CDKN2A | C0027626 | Neoplasm Invasiveness | 1 | CTD_human |
Tgene | CDKN2A | C0027819 | Neuroblastoma | 1 | CTD_human |
Tgene | CDKN2A | C0032927 | Precancerous Conditions | 1 | CTD_human |
Tgene | CDKN2A | C0036920 | Sezary Syndrome | 1 | CTD_human |
Tgene | CDKN2A | C0038356 | Stomach Neoplasms | 1 | CTD_human |
Tgene | CDKN2A | C0040100 | Thymoma | 1 | CTD_human |
Tgene | CDKN2A | C0041107 | Trisomy | 1 | CTD_human |
Tgene | CDKN2A | C0042065 | Genitourinary Neoplasms | 1 | CTD_human |
Tgene | CDKN2A | C0079744 | Diffuse Large B-Cell Lymphoma | 1 | CTD_human |
Tgene | CDKN2A | C0079773 | Lymphoma, T-Cell, Cutaneous | 1 | CTD_human |
Tgene | CDKN2A | C0151779 | Cutaneous Melanoma | 1 | CGI;CTD_human |
Tgene | CDKN2A | C0153381 | Malignant neoplasm of mouth | 1 | CTD_human |
Tgene | CDKN2A | C0205641 | Adenocarcinoma, Basal Cell | 1 | CTD_human |
Tgene | CDKN2A | C0205642 | Adenocarcinoma, Oxyphilic | 1 | CTD_human |
Tgene | CDKN2A | C0205643 | Carcinoma, Cribriform | 1 | CTD_human |
Tgene | CDKN2A | C0205644 | Carcinoma, Granular Cell | 1 | CTD_human |
Tgene | CDKN2A | C0205645 | Adenocarcinoma, Tubular | 1 | CTD_human |
Tgene | CDKN2A | C0205969 | Thymic Carcinoma | 1 | CTD_human |
Tgene | CDKN2A | C0206686 | Adrenocortical carcinoma | 1 | CTD_human |
Tgene | CDKN2A | C0206727 | Nerve Sheath Tumors | 1 | CTD_human |
Tgene | CDKN2A | C0279626 | Squamous cell carcinoma of esophagus | 1 | CTD_human |
Tgene | CDKN2A | C0279628 | Adenocarcinoma Of Esophagus | 1 | CTD_human |
Tgene | CDKN2A | C0282313 | Condition, Preneoplastic | 1 | CTD_human |
Tgene | CDKN2A | C0376407 | Granulomatous Slack Skin | 1 | CTD_human |
Tgene | CDKN2A | C0546837 | Malignant neoplasm of esophagus | 1 | CTD_human |
Tgene | CDKN2A | C0596263 | Carcinogenesis | 1 | CTD_human |
Tgene | CDKN2A | C0677866 | Brain Stem Neoplasms | 1 | CTD_human |
Tgene | CDKN2A | C0678222 | Breast Carcinoma | 1 | CTD_human |
Tgene | CDKN2A | C0750887 | Adrenal Cancer | 1 | CTD_human |
Tgene | CDKN2A | C0751569 | Genitourinary Cancer | 1 | CTD_human |
Tgene | CDKN2A | C0751606 | Adult Acute Lymphocytic Leukemia | 1 | GENOMICS_ENGLAND |
Tgene | CDKN2A | C0751689 | Peripheral Nerve Sheath Neoplasm | 1 | CTD_human |
Tgene | CDKN2A | C0751691 | Perineurioma | 1 | CTD_human |
Tgene | CDKN2A | C0751886 | Brain Stem Neoplasms, Primary | 1 | CTD_human |
Tgene | CDKN2A | C0751887 | Medullary Neoplasms | 1 | CTD_human |
Tgene | CDKN2A | C0751888 | Mesencephalic Neoplasms | 1 | CTD_human |
Tgene | CDKN2A | C0751889 | Pontine Tumors | 1 | CTD_human |
Tgene | CDKN2A | C0887833 | Carcinoma, Pancreatic Ductal | 1 | CTD_human |
Tgene | CDKN2A | C1257931 | Mammary Neoplasms, Human | 1 | CTD_human |
Tgene | CDKN2A | C1292769 | Precursor B-cell lymphoblastic leukemia | 1 | ORPHANET |
Tgene | CDKN2A | C1297882 | Partial Trisomy | 1 | CTD_human |
Tgene | CDKN2A | C1449861 | Micronuclei, Chromosome-Defective | 1 | CTD_human |
Tgene | CDKN2A | C1449862 | Micronuclei, Genotoxicant-Induced | 1 | CTD_human |
Tgene | CDKN2A | C1458155 | Mammary Neoplasms | 1 | CTD_human |
Tgene | CDKN2A | C1708349 | Hereditary Diffuse Gastric Cancer | 1 | CTD_human |
Tgene | CDKN2A | C1835042 | Melanoma astrocytoma syndrome | 1 | CTD_human;ORPHANET |
Tgene | CDKN2A | C1961099 | Precursor T-Cell Lymphoblastic Leukemia-Lymphoma | 1 | ORPHANET |
Tgene | CDKN2A | C1961102 | Precursor Cell Lymphoblastic Leukemia Lymphoma | 1 | CTD_human |
Tgene | CDKN2A | C2314896 | Familial Atypical Mole Melanoma Syndrome | 1 | ORPHANET |
Tgene | CDKN2A | C2930745 | Partial Monosomy | 1 | CTD_human |
Tgene | CDKN2A | C2931038 | Pancreatic carcinoma, familial | 1 | ORPHANET |
Tgene | CDKN2A | C2931822 | Nasopharyngeal carcinoma | 1 | CTD_human |
Tgene | CDKN2A | C4283859 | Cutaneous Malignant Melanoma 2 | 1 | GENOMICS_ENGLAND |
Tgene | CDKN2A | C4704874 | Mammary Carcinoma, Human | 1 | CTD_human |
Tgene | CDKN2A | C4721453 | Peripheral Nervous System Diseases | 1 | CTD_human |