|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:URI1-IFNL1 (FusionGDB2 ID:96410) |
Fusion Gene Summary for URI1-IFNL1 |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: URI1-IFNL1 | Fusion gene ID: 96410 | Hgene | Tgene | Gene symbol | URI1 | IFNL1 | Gene ID | 8725 | 282618 |
| Gene name | URI1 prefoldin like chaperone | interferon lambda 1 | |
| Synonyms | C19orf2|NNX3|PPP1R19|RMP|URI | IL-29|IL29 | |
| Cytomap | 19q12 | 19q13.2 | |
| Type of gene | protein-coding | protein-coding | |
| Description | unconventional prefoldin RPB5 interactor 1RNA polymerase II subunit 5-mediating proteinRPB5-mediating proteinprotein phosphatase 1, regulatory subunit 19 | interferon lambda-1IFN-lambda-1cytokine Zcyto21interleukin 29 (interferon, lambda 1)interleukin-29 | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | O94763 | . | |
| Ensembl transtripts involved in fusion gene | ENST00000360605, ENST00000542441, ENST00000392271, ENST00000312051, ENST00000574176, | ENST00000333625, | |
| Fusion gene scores | * DoF score | 30 X 13 X 12=4680 | 4 X 1 X 3=12 |
| # samples | 40 | 4 | |
| ** MAII score | log2(40/4680*10)=-3.54843662469604 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(4/12*10)=1.73696559416621 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
| Context | PubMed: URI1 [Title/Abstract] AND IFNL1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | URI1(30462134)-IFNL1(39787445), # samples:2 | ||
| Anticipated loss of major functional domain due to fusion event. | URI1-IFNL1 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | URI1 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 12737519|15367675|21730289 |
| Hgene | URI1 | GO:0001558 | regulation of cell growth | 21730289 |
| Hgene | URI1 | GO:0071363 | cellular response to growth factor stimulus | 17936702 |
| Hgene | URI1 | GO:0071383 | cellular response to steroid hormone stimulus | 21730289 |
| Tgene | IFNL1 | GO:0002829 | negative regulation of type 2 immune response | 19346497 |
| Tgene | IFNL1 | GO:0008285 | negative regulation of cell proliferation | 15166220|15899585 |
| Tgene | IFNL1 | GO:0032696 | negative regulation of interleukin-13 production | 19346497 |
| Tgene | IFNL1 | GO:0032714 | negative regulation of interleukin-5 production | 19346497 |
| Tgene | IFNL1 | GO:0032729 | positive regulation of interferon-gamma production | 19346497 |
| Tgene | IFNL1 | GO:0042531 | positive regulation of tyrosine phosphorylation of STAT protein | 15166220 |
| Tgene | IFNL1 | GO:0043381 | negative regulation of memory T cell differentiation | 19346497 |
| Tgene | IFNL1 | GO:0045345 | positive regulation of MHC class I biosynthetic process | 12483210 |
| Tgene | IFNL1 | GO:0045581 | negative regulation of T cell differentiation | 19346497 |
| Tgene | IFNL1 | GO:0045892 | negative regulation of transcription, DNA-templated | 19346497 |
| Tgene | IFNL1 | GO:0045893 | positive regulation of transcription, DNA-templated | 12483210 |
| Tgene | IFNL1 | GO:0046427 | positive regulation of JAK-STAT cascade | 12483210 |
| Tgene | IFNL1 | GO:0051607 | defense response to virus | 12469119 |
| Fusion gene breakpoints across URI1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Fusion gene breakpoints across IFNL1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BRCA | TCGA-A2-A3XX-01A | URI1 | chr19 | 30462134 | + | IFNL1 | chr19 | 39787445 | + |
| ChimerDB4 | BRCA | TCGA-A2-A3XX-01A | URI1 | chr19 | 30462134 | + | IFNL1 | chr19 | 39787445 | + |
| ChimerDB4 | BRCA | TCGA-A2-A3XX-01A | URI1 | chr19 | 30433571 | + | IFNL1 | chr19 | 39787445 | + |
Top |
Fusion Gene ORF analysis for URI1-IFNL1 |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| Frame-shift | ENST00000360605 | ENST00000333625 | URI1 | chr19 | 30462134 | + | IFNL1 | chr19 | 39787445 | + |
| Frame-shift | ENST00000542441 | ENST00000333625 | URI1 | chr19 | 30462134 | + | IFNL1 | chr19 | 39787445 | + |
| 5UTR-3CDS | ENST00000392271 | ENST00000333625 | URI1 | chr19 | 30462134 | + | IFNL1 | chr19 | 39787445 | + |
| intron-3CDS | ENST00000312051 | ENST00000333625 | URI1 | chr19 | 30462134 | + | IFNL1 | chr19 | 39787445 | + |
| intron-3CDS | ENST00000574176 | ENST00000333625 | URI1 | chr19 | 30462134 | + | IFNL1 | chr19 | 39787445 | + |
| intron-3CDS | ENST00000360605 | ENST00000333625 | URI1 | chr19 | 30433571 | + | IFNL1 | chr19 | 39787445 | + |
| In-frame | ENST00000542441 | ENST00000333625 | URI1 | chr19 | 30433571 | + | IFNL1 | chr19 | 39787445 | + |
| 5UTR-3CDS | ENST00000392271 | ENST00000333625 | URI1 | chr19 | 30433571 | + | IFNL1 | chr19 | 39787445 | + |
| Frame-shift | ENST00000312051 | ENST00000333625 | URI1 | chr19 | 30433571 | + | IFNL1 | chr19 | 39787445 | + |
| intron-3CDS | ENST00000574176 | ENST00000333625 | URI1 | chr19 | 30433571 | + | IFNL1 | chr19 | 39787445 | + |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000542441 | URI1 | chr19 | 30433571 | + | ENST00000333625 | IFNL1 | chr19 | 39787445 | + | 1003 | 414 | 297 | 845 | 182 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000542441 | ENST00000333625 | URI1 | chr19 | 30433571 | + | IFNL1 | chr19 | 39787445 | + | 0.10620607 | 0.8937939 |
Top |
Fusion Genomic Features for URI1-IFNL1 |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| URI1 | chr19 | 30462134 | + | IFNL1 | chr19 | 39787444 | + | 3.82E-07 | 0.99999964 |
| URI1 | chr19 | 30433571 | + | IFNL1 | chr19 | 39787444 | + | 8.57E-12 | 1 |
| URI1 | chr19 | 30462134 | + | IFNL1 | chr19 | 39787444 | + | 3.82E-07 | 0.99999964 |
| URI1 | chr19 | 30433571 | + | IFNL1 | chr19 | 39787444 | + | 8.57E-12 | 1 |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for URI1-IFNL1 |
| Go to FGviewer for the breakpoints of chr19:30433571-chr19:39787445 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| URI1 | . |
| FUNCTION: Involved in gene transcription regulation. Acts as a transcriptional repressor in concert with the corepressor UXT to regulate androgen receptor (AR) transcription. May act as a tumor suppressor to repress AR-mediated gene transcription and to inhibit anchorage-independent growth in prostate cancer cells. Required for cell survival in ovarian cancer cells. Together with UXT, associates with chromatin to the NKX3-1 promoter region. Antagonizes transcriptional modulation via hepatitis B virus X protein.; FUNCTION: Plays a central role in maintaining S6K1 signaling and BAD phosphorylation under normal growth conditions thereby protecting cells from potential deleterious effects of sustained S6K1 signaling. The URI1-PPP1CC complex acts as a central component of a negative feedback mechanism that counteracts excessive S6K1 survival signaling to BAD in response to growth factors. Mediates inhibition of PPP1CC phosphatase activity in mitochondria. Coordinates the regulation of nutrient-sensitive gene expression availability in a mTOR-dependent manner. Seems to be a scaffolding protein able to assemble a prefoldin-like complex that contains PFDs and proteins with roles in transcription and ubiquitination. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | URI1 | chr19:30433571 | chr19:39787445 | ENST00000360605 | + | 1 | 11 | 299_311 | 0 | 476.0 | Compositional bias | Note=Poly-Asp |
| Hgene | URI1 | chr19:30433571 | chr19:39787445 | ENST00000360605 | + | 1 | 11 | 314_321 | 0 | 476.0 | Compositional bias | Note=Poly-Asp |
| Hgene | URI1 | chr19:30433571 | chr19:39787445 | ENST00000392271 | + | 1 | 11 | 299_311 | 0 | 460.0 | Compositional bias | Note=Poly-Asp |
| Hgene | URI1 | chr19:30433571 | chr19:39787445 | ENST00000392271 | + | 1 | 11 | 314_321 | 0 | 460.0 | Compositional bias | Note=Poly-Asp |
| Hgene | URI1 | chr19:30433571 | chr19:39787445 | ENST00000542441 | + | 1 | 11 | 299_311 | 39.0 | 536.0 | Compositional bias | Note=Poly-Asp |
| Hgene | URI1 | chr19:30433571 | chr19:39787445 | ENST00000542441 | + | 1 | 11 | 314_321 | 39.0 | 536.0 | Compositional bias | Note=Poly-Asp |
Top |
Fusion Gene Sequence for URI1-IFNL1 |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >In-frame_ENST00000542441_ENST00000333625_TCGA-A2-A3XX-01A_URI1_chr19_30433571_+_IFNL1_chr19_39787445_length(transcript)=1003nt_BP=414nt GCGGCCGCCACGCGACGCCTGGCTGGGCCCGCACCGGAGAGGCGTCTCGGTACCTGGCAGGCGGCCTGCTACTCGGAGCCCGCTGCGGGG CGGCGGCGGCGGGGACATGCACGTGTGAGATGCGGCAGCGGGCGGCGCGGACGCGAACAGCAGCGGCGGCGGCGGGCGCGGCCTCCTGGG CGCGGGGCGCGCGGTGCCTGAGGGCGGGCGCGCGGGCGCTGGGCAACTGCCGGCCGCGCCGCCTGCGCAGGCGCTGGTTCAGGACTCACA CGCCGCGCTGAGGCCCGCGGGCCCGTCATGGAGGCGCCCACCGTGGAGACGCCCCCCGACCCCTCGCCCCCTTCGGCCCCGGCCCCTGCC CTGGTTCCGTTGCGCGCCCCGGATGTGGCGCGGCTGCGCGAGGAGCAGGAAAAGGAAGAGTCACTCAAGCTGAAAAACTGGAGTTGCAGC TCTCCTGTCTTCCCCGGGAATTGGGACCTGAGGCTTCTCCAGGTGAGGGAGCGCCCTGTGGCCTTGGAGGCTGAGCTGGCCCTGACGCTG AAGGTCCTGGAGGCCGCTGCTGGCCCAGCCCTGGAGGACGTCCTAGACCAGCCCCTTCACACCCTGCACCACATCCTCTCCCAGCTCCAG GCCTGTATCCAGCCTCAGCCCACAGCAGGGCCCAGGCCCCGGGGCCGCCTCCACCACTGGCTGCACCGGCTCCAGGAGGCCCCCAAAAAG GAGTCCGCTGGCTGCCTGGAGGCATCTGTCACCTTCAACCTCTTCCGCCTCCTCACGCGAGACCTCAAATATGTGGCCGATGGGAACCTG TGTCTGAGAACGTCAACCCACCCTGAGTCCACCTGACACCCCACACCTTATTTATGCGCTGAGCCCTACTCCTTCCTTAATTTATTTCCT CTCACCCTTTATTTATGAAGCTGCAGCCCTGACTGAGACATAGGGCTGAGTTTATTGTTTTACTTTTATACATTATGCACAAATAAACAA >In-frame_ENST00000542441_ENST00000333625_TCGA-A2-A3XX-01A_URI1_chr19_30433571_+_IFNL1_chr19_39787445_length(amino acids)=182AA_start in transcript=297_stop in transcript=845 MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGP ALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPE -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for URI1-IFNL1 |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for URI1-IFNL1 |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for URI1-IFNL1 |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Hgene | URI1 | C0007097 | Carcinoma | 1 | CTD_human |
| Hgene | URI1 | C0027659 | Neoplasms, Experimental | 1 | CTD_human |
| Hgene | URI1 | C0205696 | Anaplastic carcinoma | 1 | CTD_human |
| Hgene | URI1 | C0205697 | Carcinoma, Spindle-Cell | 1 | CTD_human |
| Hgene | URI1 | C0205698 | Undifferentiated carcinoma | 1 | CTD_human |
| Hgene | URI1 | C0205699 | Carcinomatosis | 1 | CTD_human |
| Hgene | URI1 | C0919267 | ovarian neoplasm | 1 | CTD_human |
| Hgene | URI1 | C1140680 | Malignant neoplasm of ovary | 1 | CTD_human |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies