|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:ZC2HC1A-ANGPT1 (FusionGDB2 ID:99822) |
Fusion Gene Summary for ZC2HC1A-ANGPT1 |
Fusion gene summary |
Fusion gene information | Fusion gene name: ZC2HC1A-ANGPT1 | Fusion gene ID: 99822 | Hgene | Tgene | Gene symbol | ZC2HC1A | ANGPT1 | Gene ID | 51101 | 284 |
Gene name | zinc finger C2HC-type containing 1A | angiopoietin 1 | |
Synonyms | C8orf70|CGI-62|FAM164A | AGP1|AGPT|ANG1 | |
Cytomap | 8q21.13 | 8q23.1 | |
Type of gene | protein-coding | protein-coding | |
Description | zinc finger C2HC domain-containing protein 1Afamily with sequence similarity 164, member Aprotein FAM164A | angiopoietin-1ANG-1 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q96GY0 | Q15389 | |
Ensembl transtripts involved in fusion gene | ENST00000263849, ENST00000521176, | ENST00000520052, ENST00000520734, ENST00000518386, | |
Fusion gene scores | * DoF score | 1 X 1 X 1=1 | 8 X 4 X 7=224 |
# samples | 1 | 8 | |
** MAII score | log2(1/1*10)=3.32192809488736 | log2(8/224*10)=-1.48542682717024 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: ZC2HC1A [Title/Abstract] AND ANGPT1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | ZC2HC1A(79610748)-ANGPT1(108276579), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | ANGPT1 | GO:0001936 | regulation of endothelial cell proliferation | 8980223 |
Tgene | ANGPT1 | GO:0002040 | sprouting angiogenesis | 9560344|10218485 |
Tgene | ANGPT1 | GO:0002092 | positive regulation of receptor internalization | 19424712 |
Tgene | ANGPT1 | GO:0007162 | negative regulation of cell adhesion | 19674970 |
Tgene | ANGPT1 | GO:0007171 | activation of transmembrane receptor protein tyrosine kinase activity | 19424712 |
Tgene | ANGPT1 | GO:0010595 | positive regulation of endothelial cell migration | 12958144 |
Tgene | ANGPT1 | GO:0014842 | regulation of skeletal muscle satellite cell proliferation | 19733541 |
Tgene | ANGPT1 | GO:0030210 | heparin biosynthetic process | 19297368 |
Tgene | ANGPT1 | GO:0031398 | positive regulation of protein ubiquitination | 19689429 |
Tgene | ANGPT1 | GO:0034394 | protein localization to cell surface | 19615361 |
Tgene | ANGPT1 | GO:0043066 | negative regulation of apoptotic process | 10218485|12958144 |
Tgene | ANGPT1 | GO:0043116 | negative regulation of vascular permeability | 14978158|19297368 |
Tgene | ANGPT1 | GO:0043536 | positive regulation of blood vessel endothelial cell migration | 9660821 |
Tgene | ANGPT1 | GO:0048014 | Tie signaling pathway | 19689429|19922791 |
Tgene | ANGPT1 | GO:0050731 | positive regulation of peptidyl-tyrosine phosphorylation | 15851516|19689429 |
Tgene | ANGPT1 | GO:0050918 | positive chemotaxis | 9660821 |
Tgene | ANGPT1 | GO:0051897 | positive regulation of protein kinase B signaling | 18425120|19615361 |
Tgene | ANGPT1 | GO:0070374 | positive regulation of ERK1 and ERK2 cascade | 18425120|19615361 |
Tgene | ANGPT1 | GO:2000352 | negative regulation of endothelial cell apoptotic process | 19674970 |
Fusion gene breakpoints across ZC2HC1A (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across ANGPT1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BLCA | TCGA-ZF-A9RL-01A | ZC2HC1A | chr8 | 79610748 | + | ANGPT1 | chr8 | 108276579 | - |
ChimerDB4 | BLCA | TCGA-ZF-A9RL-01A | ZC2HC1A | chr8 | 79610748 | + | ANGPT1 | chr8 | 108276579 | - |
Top |
Fusion Gene ORF analysis for ZC2HC1A-ANGPT1 |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
In-frame | ENST00000263849 | ENST00000520052 | ZC2HC1A | chr8 | 79610748 | + | ANGPT1 | chr8 | 108276579 | - |
In-frame | ENST00000263849 | ENST00000520734 | ZC2HC1A | chr8 | 79610748 | + | ANGPT1 | chr8 | 108276579 | - |
5CDS-5UTR | ENST00000263849 | ENST00000518386 | ZC2HC1A | chr8 | 79610748 | + | ANGPT1 | chr8 | 108276579 | - |
intron-3CDS | ENST00000521176 | ENST00000520052 | ZC2HC1A | chr8 | 79610748 | + | ANGPT1 | chr8 | 108276579 | - |
intron-3CDS | ENST00000521176 | ENST00000520734 | ZC2HC1A | chr8 | 79610748 | + | ANGPT1 | chr8 | 108276579 | - |
intron-5UTR | ENST00000521176 | ENST00000518386 | ZC2HC1A | chr8 | 79610748 | + | ANGPT1 | chr8 | 108276579 | - |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000263849 | ZC2HC1A | chr8 | 79610748 | + | ENST00000520052 | ANGPT1 | chr8 | 108276579 | - | 1441 | 806 | 102 | 1097 | 331 |
ENST00000263849 | ZC2HC1A | chr8 | 79610748 | + | ENST00000520734 | ANGPT1 | chr8 | 108276579 | - | 1441 | 806 | 102 | 1097 | 331 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000263849 | ENST00000520052 | ZC2HC1A | chr8 | 79610748 | + | ANGPT1 | chr8 | 108276579 | - | 0.008972242 | 0.9910278 |
ENST00000263849 | ENST00000520734 | ZC2HC1A | chr8 | 79610748 | + | ANGPT1 | chr8 | 108276579 | - | 0.008972242 | 0.9910278 |
Top |
Fusion Genomic Features for ZC2HC1A-ANGPT1 |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for ZC2HC1A-ANGPT1 |
Go to FGviewer for the breakpoints of chr8:79610748-chr8:108276579 - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
ZC2HC1A | ANGPT1 |
FUNCTION: Binds and activates TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation. Plays an important role in the regulation of angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Required for normal angiogenesis and heart development during embryogenesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. Mediates blood vessel maturation/stability. Implicated in endothelial developmental processes later and distinct from that of VEGF. Appears to play a crucial role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme. {ECO:0000269|PubMed:15284220, ECO:0000269|PubMed:18425119, ECO:0000269|PubMed:18425120, ECO:0000269|PubMed:9204896}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ZC2HC1A | chr8:79610748 | chr8:108276579 | ENST00000263849 | + | 7 | 9 | 15_39 | 234.66666666666666 | 326.0 | Zinc finger | Note=C2HC-type |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Top |
Fusion Gene Sequence for ZC2HC1A-ANGPT1 |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>In-frame_ENST00000263849_ENST00000520052_TCGA-ZF-A9RL-01A_ZC2HC1A_chr8_79610748_+_ANGPT1_chr8_108276579_length(transcript)=1441nt_BP=806nt GGAATGTTAGCGGGTGGGAGGTGCGGCTGGGTTGCTACAGCCAGAGCTGGGCGGTGGCGGGCGCTGCTGAAGGAGTCTCGCTGAGCTCGA GGAGGTGGCGCGATGGAGGGACTGGAAGAGAATGGAGGTGTTGTCCAAGTTGGAGAATTGTTACCTTGCAAGATTTGTGGAAGAACATTC TTTCCAGTAGCATTAAAAAAACATGGACCCATTTGCCAGAAGACTGCAACTAAAAAACGGAAGACTTTTGATTCAAGCAGACAGAGAGCT GAAGGAACTGATATTCCAACAGTAAAACCTCTCAAACCGAGGCCAGAACCACCAAAGAAACCATCTAATTGGAGAAGGAAACATGAAGAA TTCATTGCTACCATAAGAGCAGCTAAAGGCCTTGATCAGGCCCTCAAAGAGGGTGGCAAACTTCCTCCTCCTCCTCCACCTTCTTATGAT CCTGATTATATTCAATGTCCATATTGTCAGAGGAGATTCAATGAAAATGCAGCTGATAGACATATAAATTTCTGTAAAGAACAGGCAGCA CGTATTAGTAATAAAGGGAAATTTTCTACAGATACCAAAGGAAAACCAACTTCTCGGACACAGGTGTATAAGCCACCCGCACTTAAAAAG TCAAATTCTCCTGGAACTGCATCATCAGGATCTTCACGATTACCGCAGCCAAGTGGCGCTGGCAAAACTGTTGTAGGTGTTCCTTCAGGT AAAGTGTCTTCAAGTAGCAGCTCTTTGGGAAACAAACTTCAGACCTTATCTCCCTCTCATAAAGGGATAGCAGCCCCTCATGCAGGGTTG TATTTAAAAGGTCACACTGGGACAGCAGGAAAACAGAGCAGCCTGATCTTACACGGTGCTGATTTCAGCACTAAAGATGCTGATAATGAC AACTGTATGTGCAAATGTGCCCTCATGTTAACAGGAGGATGGTGGTTTGATGCTTGTGGCCCCTCCAATCTAAATGGAATGTTCTATACT GCGGGACAAAACCATGGAAAACTGAATGGGATAAAGTGGCACTACTTCAAAGGGCCCAGTTACTCCTTACGTTCCACAACTATGATGATT CGACCTTTAGATTTTTGAAAGCGCAATGTCAGAAGCGATTATGAAAGCAACAAAGAAATCCGGAGAAGCTGCCAGGTGAGAAACTGTTTG AAAACTTCAGAAGCAAACAATATTGTCTCCCTTCCAGCAATAAGTGGTAGTTATGTGAAGTCACCAAGGTTCTTGACCGTGAATCTGGAG CCGTTTGAGTTCACAAGAGTCTCTACTTGGGGTGACAGTGCTCACGTGGCTCGACTATAGAAAACTCCACTGACTGTCGGGCTTTAAAAA GGGAAGAAACTGCTGAGCTTGCTGTGCTTCAAACTACTACTGGACCTTATTTTGGAACTATGGTAGCCAGATGATAAATATGGTTAATTT >In-frame_ENST00000263849_ENST00000520052_TCGA-ZF-A9RL-01A_ZC2HC1A_chr8_79610748_+_ANGPT1_chr8_108276579_length(amino acids)=331AA_start in transcript=102_stop in transcript=1097 MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPRPEPPKKPSNWRRKHEEFIAT IRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSP GTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMC -------------------------------------------------------------- >In-frame_ENST00000263849_ENST00000520734_TCGA-ZF-A9RL-01A_ZC2HC1A_chr8_79610748_+_ANGPT1_chr8_108276579_length(transcript)=1441nt_BP=806nt GGAATGTTAGCGGGTGGGAGGTGCGGCTGGGTTGCTACAGCCAGAGCTGGGCGGTGGCGGGCGCTGCTGAAGGAGTCTCGCTGAGCTCGA GGAGGTGGCGCGATGGAGGGACTGGAAGAGAATGGAGGTGTTGTCCAAGTTGGAGAATTGTTACCTTGCAAGATTTGTGGAAGAACATTC TTTCCAGTAGCATTAAAAAAACATGGACCCATTTGCCAGAAGACTGCAACTAAAAAACGGAAGACTTTTGATTCAAGCAGACAGAGAGCT GAAGGAACTGATATTCCAACAGTAAAACCTCTCAAACCGAGGCCAGAACCACCAAAGAAACCATCTAATTGGAGAAGGAAACATGAAGAA TTCATTGCTACCATAAGAGCAGCTAAAGGCCTTGATCAGGCCCTCAAAGAGGGTGGCAAACTTCCTCCTCCTCCTCCACCTTCTTATGAT CCTGATTATATTCAATGTCCATATTGTCAGAGGAGATTCAATGAAAATGCAGCTGATAGACATATAAATTTCTGTAAAGAACAGGCAGCA CGTATTAGTAATAAAGGGAAATTTTCTACAGATACCAAAGGAAAACCAACTTCTCGGACACAGGTGTATAAGCCACCCGCACTTAAAAAG TCAAATTCTCCTGGAACTGCATCATCAGGATCTTCACGATTACCGCAGCCAAGTGGCGCTGGCAAAACTGTTGTAGGTGTTCCTTCAGGT AAAGTGTCTTCAAGTAGCAGCTCTTTGGGAAACAAACTTCAGACCTTATCTCCCTCTCATAAAGGGATAGCAGCCCCTCATGCAGGGTTG TATTTAAAAGGTCACACTGGGACAGCAGGAAAACAGAGCAGCCTGATCTTACACGGTGCTGATTTCAGCACTAAAGATGCTGATAATGAC AACTGTATGTGCAAATGTGCCCTCATGTTAACAGGAGGATGGTGGTTTGATGCTTGTGGCCCCTCCAATCTAAATGGAATGTTCTATACT GCGGGACAAAACCATGGAAAACTGAATGGGATAAAGTGGCACTACTTCAAAGGGCCCAGTTACTCCTTACGTTCCACAACTATGATGATT CGACCTTTAGATTTTTGAAAGCGCAATGTCAGAAGCGATTATGAAAGCAACAAAGAAATCCGGAGAAGCTGCCAGGTGAGAAACTGTTTG AAAACTTCAGAAGCAAACAATATTGTCTCCCTTCCAGCAATAAGTGGTAGTTATGTGAAGTCACCAAGGTTCTTGACCGTGAATCTGGAG CCGTTTGAGTTCACAAGAGTCTCTACTTGGGGTGACAGTGCTCACGTGGCTCGACTATAGAAAACTCCACTGACTGTCGGGCTTTAAAAA GGGAAGAAACTGCTGAGCTTGCTGTGCTTCAAACTACTACTGGACCTTATTTTGGAACTATGGTAGCCAGATGATAAATATGGTTAATTT >In-frame_ENST00000263849_ENST00000520734_TCGA-ZF-A9RL-01A_ZC2HC1A_chr8_79610748_+_ANGPT1_chr8_108276579_length(amino acids)=331AA_start in transcript=102_stop in transcript=1097 MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPRPEPPKKPSNWRRKHEEFIAT IRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSP GTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMC -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for ZC2HC1A-ANGPT1 |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for ZC2HC1A-ANGPT1 |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for ZC2HC1A-ANGPT1 |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Tgene | ANGPT1 | C0016059 | Fibrosis | 2 | CTD_human |
Tgene | ANGPT1 | C1623038 | Cirrhosis | 2 | CTD_human |
Tgene | ANGPT1 | C0020564 | Hypertrophy | 1 | CTD_human |
Tgene | ANGPT1 | C0021368 | Inflammation | 1 | CTD_human |
Tgene | ANGPT1 | C0034189 | Pyemia | 1 | CTD_human |
Tgene | ANGPT1 | C0036690 | Septicemia | 1 | CTD_human |
Tgene | ANGPT1 | C0243026 | Sepsis | 1 | CTD_human |
Tgene | ANGPT1 | C1719672 | Severe Sepsis | 1 | CTD_human |