FusionGDB Logo

Home

Download

Statistics

Examples

About

Contact

Center for Computational Systems Medicine
leaf

Fusion Gene Summary

leaf

Fusion Gene Breakpoints

leaf

Tumorigenic MoA (Mechanism of Action) Scenarios of Fusion Geness

leaf

Fusion Genomic Features

leaf

Fusion Gene ORF Annotations

leaf

Fusion Protein Retained/Non-Retained Functional Features

leaf

Fusion Transcript Sequences

leaf

Fusion Protein Sequences

leaf

Personalized Fusion Protein Sequences

leaf

Fusion Gene Expressed Samples

leaf

Related Drugs

Fusion gene:BCL2L2_CAPN8 (FusionGDB2 ID:HG599TG388743)

Fusion Gene Summary for BCL2L2_CAPN8

check button Fusion gene summary
Fusion gene informationFusion gene name: BCL2L2_CAPN8
Fusion gene ID: hg599tg388743
HgeneTgene
Gene symbol

BCL2L2

CAPN8

Gene ID

599

388743

Gene nameBCL2 like 2calpain 8
SynonymsBCL-W|BCL2-L-2|BCLW|PPP1R51nCL-2
Cytomap

14q11.2

1q41

Type of geneprotein-codingprotein-coding
Descriptionbcl-2-like protein 2apoptosis regulator BCL-Wprotein phosphatase 1, regulatory subunit 51calpain-8new calpain 2stomach-specific M-type calpain
Modification date2024041120240305
UniProtAcc..
Ensembl transtripts involved in fusion geneENST00000250405, 
Fusion gene scores* DoF score* DoF score (Degree of Frequency) = # partners X # break points X # disease types
9 X 11 X 7=693
* DoF score (Degree of Frequency) = # partners X # break points X # disease types
11 X 3 X 7=231
# samples 8114
** MAII score** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)
log2(81/693*10)=0.225066555634773
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)
log2(14/231*10)=-0.722466024471091
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: BCL2L2 [Title/Abstract] AND CAPN8 [Title/Abstract] AND fusion [Title/Abstract]

Most frequent breakpointBCL2L2(23777408)-CAPN8(223718212), # samples:1

check buttonFusion gene breakpoints across BCL2L2 (5'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
all structure
check buttonFusion gene breakpoints across CAPN8 (3'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
all structure

Top

Fusion Gene Breakpoints for BCL2L2_CAPN8


check button RNA-seq based exon junction arranged fusion gene breakpoints from 8 resources (TCGA, CCLE, cBioPortal, GenBank, ChimerDB, ChimerKB, ChildHoodFusions, and GTEx). For the expressed sample information, go to Fusion Gene Sample section.
HgeneHchrHbpTgeneTchrTbp
BCL2L2chr1423777408CAPN8chr1223718212


check button DNA-seq based exon junction arranged fusion gene breakpoints from dbVar. For the expressed sample information, go to Fusion Gene Sample section.
HgeneHchrHbpTgeneTchrTbpSV type


Top

Tumorigenic MoA (Mechanism of Action) Scenarios of Fusion Genes for BCL2L2_CAPN8


check button To generate these tumorigenic scenario annotations, we implemented a deduction-first, retrieval-later computational framework. The pipeline first applies rule-guided reasoning across ten core mechanistic categories (M1–M10) derived from fusion gene biology to infer candidate mechanisms, tumorigenic scenarios, targeting points, and targeting backgrounds. To ensure empirical accountability, a governed Python workflow retrieves literature candidates via NCBI E-utilities and Europe PMC using tiered searches. Using JSON Schema-constrained LLM evidence judges (GPT-5.6 Luna and Terra), retrieved articles are evaluated for specificity and confidence without de novo PMID generation. This produces two distinct versions: a strict version restricted to high- or medium-confidence fusion-specific evidence, and an extended version incorporating broader gene-, pathway-, and contextual evidence.
* We have 10 tumorigenic mechanism categories of fusion genes as shown below.
Constitutively Active Kinases, Catalytic Domain Dysregulation, & Transmembrane Ligand FusionsAberrant Chimeric Transcription Factor / Fusion Transcription Factor ActivityEpigenetic Reprogramming / Histone Modifier DysregulationChromatin Remodeling DysregulationCondensate-Driven Transcriptional Rewiring / LLPPromoter / Enhancer HijackingDominant-Negative AntagonismCell Cycle / Checkpoint Bypass / RNA Processing DysregulationSubcellular Mislocalization / Spatial DysregulationNuclear Body / Sub-organellar Architecture Disruption & Differentiation Blockade

* Strict version: Restricted to high- or medium-confidence fusion-specific evidence.
Fusion Gene NameMechanism CategoryMechanism PubMedTumorigenic ScenariosTumorigenic Scenario PubMedTargeting PointsTargeting PubMedMechanism BackgroundMechanism Background PubMed
BCL2L2-CAPN8
Promoter / Enhancer Hijacking
Promoter swap alters calpain-8 expression, modifying calcium-dependent mucosal proteolysis and cellular motility.Calpain inhibitors; calcium modulatorsGastrointestinal carcinomas

* Extended version: Includes all strict-level fusion evidence plus broader gene-, pathway-, and low-confidence contextual evidence.
Fusion Gene NameMechanism CategoryMechanism PubMedTumorigenic ScenariosTumorigenic Scenario PubMedTargeting PointsTargeting PubMedMechanism BackgroundMechanism Background PubMed
BCL2L2-CAPN8
Promoter / Enhancer Hijacking
Promoter swap alters calpain-8 expression, modifying calcium-dependent mucosal proteolysis and cellular motility.Evidence level: Limited indirect gene evidence; Confidence: Low; PMID: 20686710; Title: Calpain 8/nCL-2 and calpain 9/nCL-4 constitute an active protease complex, G-calpain, involved in gastric mucosal defense.Calpain inhibitors; calcium modulatorsEvidence level: Limited indirect gene evidence; Confidence: Low; PMID: 20686710; Title: Calpain 8/nCL-2 and calpain 9/nCL-4 constitute an active protease complex, G-calpain, involved in gastric mucosal defense.Gastrointestinal carcinomas

check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
..

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneBCL2L2

GO:0042981

regulation of apoptotic process

16697956


Top

Fusion Genomic Features for BCL2L2_CAPN8


check buttonFusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence) of In-frame fusion genes. FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints.
HgeneHchrHbpHstrandTgeneTchrTbpTstrand1-pp (fusion gene breakpoint)
BCL2L2chr1423777408+CAPN8chr1223718212-1.47e-029.85e-01


check buttonFusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence) of 5UTR-3CSD fusion genes (N-truncated cases).
HgeneHchrHbpHstrandTgeneTchrTbpTstrand1-pp (fusion gene breakpoint)

check buttonFusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence) of 5CDS-3UTR fusion genes (C-truncated cases).
HgeneHchrHbpHstrandTgeneTchrTbpTstrand1-pp (fusion gene breakpoint)

check buttonDistribution of six genomic regulatory feature tracks across a ±5 kb window centered on the fusion breakpoints. We input the breakpoint sequences into AlphaGenome and obtained predicted genome tracks at single-base-pair resolution for each modality by running a single forward pass over the reference sequence. Specifically, for each breakpoint, AlphaGenome processed and returned predicted track data across diverse modalities, which were then averaged across all tracks within each output type and visualized across the ±5 kb window. The left panel shows the 5'-gene breakpoint ±5 kb area, and the right panel shows the 3'-gene breakpoint area, with tracks grouped by category: chromatin accessibility (DNase-seq, ATAC-seq), active transcription (RNA-seq, CAGE), and chromatin binding (ChIP-Histone, ChIP-TF).
genomic feature

Top

Fusion Gene ORF Annotations for BCL2L2_CAPN8

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000250405ENST00000366872BCL2L2chr14

23777408

+CAPN8chr1

223718212

-

check buttonORFfinder Result Based On The Fusion Transcript Sequences of the In-frame Fusion Genes.
HenstTenstHgeneHchrHbpTgeneTchrTbpSeq length
(transcript)
Seq length
(peptide)
ENST00000250405ENST00000366872BCL2L2chr1423777408CAPN8chr1223718212661388

check buttonORFfinder Result Based On The Fusion Transcript Sequences of the 5UTR-3CDS Fusion Genes for N-Truncated Protein Search.
HenstTenstHgeneHchrHbpTgeneTchrTbpSeq length
(transcript)
Seq length
(peptide)

check buttonORFfinder Result Based On The Fusion Transcript Sequences of the 5CDS-3UTR Fusion Genes for C-Truncated Protein Search.
HenstTenstHgeneHchrHbpTgeneTchrTbpSeq length
(transcript)
Seq length
(peptide)

check buttonDeepORF Prediction of The Coding Potential Based on The Fusion Transcript Sequence of In-frame Fusion Genes. DeepORF is a Coding Potential Classifier Based on Convolutional Neural Network by Comparing the Real Ribo-seq Data. If the No-coding Score < 0.5 and Coding Score > 0.5, Then The In-frame Fusion Transcript is Predicted as Being Likely Translated.
HenstTenstHgeneHchrHbpTgeneTchrTbpNo-coding scoreCoding score
ENST00000250405ENST00000366872BCL2L2chr1423777408CAPN8chr12237182127.63e-049.99e-01

check buttonDeepORF Prediction of The Coding Potential Based on The Fusion Transcript Sequence of 5UTR-3CDS Fusion Genes (Potential N-Truncated Proteins).
HenstTenstHgeneHchrHbpTgeneTchrTbpNo-coding scoreCoding score

check buttonDeepORF Prediction of The Coding Potential Based on The Fusion Transcript Sequence of 5CDS-3UTR Fusion Genes (Potential C-Truncated Proteins).
HenstTenstHgeneHchrHbpTgeneTchrTbpNo-coding scoreCoding score

Top

Fusion Protein Retained/Non-Retained Functional Features for BCL2L2_CAPN8

check buttonProtein Level Annotation from FGviewer
* Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at download page. Minus value of BPloci means that the break pointn is located before the CDS.
fgviewer annotation
- In-frame and retained protein feature among the 13 regional features (visualization across fusion protein length).
BCL2L2_CAPN8_chr14-23777408_chr1-223718212.png
BCL2L2_CAPN8_chr14-23777408_chr1-223718212.png

- In-frame and retained protein feature among the 13 regional features (texts).
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBCL2L2chr14:23777408chr1:223718212ENST00000250405Q928433485_104144.0194.0MotifNote=BH1
HgeneBCL2L2chr14:23777408chr1:223718212ENST00000250405Q92843349_29144.0194.0MotifNote=BH4
TgeneCAPN8chr14:23777408chr1:223718212ENST00000366872A6NHC01520618_640589.0682.0DomainEF-hand 2
TgeneCAPN8chr14:23777408chr1:223718212ENST00000366872A6NHC01520670_703589.0682.0DomainEF-hand 3

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneBCL2L2chr14:23777408chr1:223718212ENST00000250405Q9284334136_151144.0194.0MotifNote=BH2
TgeneCAPN8chr14:23777408chr1:223718212ENST00000366872A6NHC0152045_344589.0682.0DomainCalpain catalytic
TgeneCAPN8chr14:23777408chr1:223718212ENST00000366872A6NHC01520575_610589.0682.0DomainEF-hand 1
TgeneCAPN8chr14:23777408chr1:223718212ENST00000366872A6NHC01520356_379589.0682.0RegionNote=Domain III


check button - Retained PPIs in in-frame fusion.
PartnerHgeneHbpTgeneTbpENSTUniProtStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerHgeneHbpTgeneTbpENSTUniProtStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

Fusion Transcript Sequence for BCL2L2_CAPN8

check button In-frame Fusion Transcript Sequences.
>BCL2L2_CAPN8_ENST00000250405_ENST00000366872_23777408_223718212 length=1156nt
Breakpoint=661nt
ATCACCCGGCGCCGGGCCCTCCCTCTGCCCCCCCCTTTCTCCTCCCTCCTTCCTTCCCTCCCTTCCTCCCTCTCTCCCTCCCTCCCAGCTCCTGCACCAGGAAACGGCCCGGATCCCGGCAGCGGCCTGACCCGGCTCCACGCTGGCCAG
GAGGATGAAAGGCCCCAGCTGGGGGCTCCTTGCCACCAGTGCTGTGTCTTAAGAGCTGCCATCCCGGCTGGCCGCCCGGATGGCGACCCCAGCCTCGGCCCCAGACACACGGGCTCTGGTGGCAGACTTTGTAGGTTATAAGCTGAGGCA
GAAGGGTTATGTCTGTGGAGCTGGCCCCGGGGAGGGCCCAGCAGCTGACCCGCTGCACCAAGCCATGCGGGCAGCTGGAGATGAGTTCGAGACCCGCTTCCGGCGCACCTTCTCTGATCTGGCGGCTCAGCTGCATGTGACCCCAGGCTC
AGCCCAACAACGCTTCACCCAGGTCTCCGATGAACTTTTTCAAGGGGGCCCCAACTGGGGCCGCCTTGTAGCCTTCTTTGTCTTTGGGGCTGCACTGTGTGCTGAGAGTGTCAACAAGGAGATGGAACCACTGGTGGGACAAGTGCAGGA
GTGGATGGTGGCCTACCTGGAGACGCAGCTGGCTGACTGGATCCACAGCAGTGGGGGCTGGGAGATCTATTGGGAAACTGATTATAACCACTCGGGCACCATCGATGCCCACGAGATGAGGACAGCCCTCAGGAAGGCAGGTTTCACCCT
CAACAGCCAGGTGCAGCAGACCATTGCCCTGCGGTATGCGTGCAGCAAGCTCGGCATCAACTTTGACAGCTTCGTGGCTTGTATGATCCGCCTGGAGACCCTCTTCAAACTATTCAGCCTTCTGGACGAAGACAAGGATGGCATGGTTCA
GCTCTCTCTGGCCGAGTGGCTGTGCTGCGTGTTGGTCTGACCCGGGGTTTCGGACATCAGTGACACTCCCTGCCCCACTGCTTGCTTCTTGTCACCCCTTCTCTACAATTTTGTGAACATTTATGCTCCAGTGGCATTCACTGGTTGTTC
ATACCTTTCTTGCCCTGGGTCTATTTCAGCAGCACTGAGCTATGAGCTATGTAAGCCGACCCGGTGGGCCCAGTGGAGGGAAAGCAATCAATTAAAGTTGTGAGCC


check button N-Truncated Transcript (5UTR-3CDS) Sequences

check button C-Truncated Transcript (5CDS-3UTR) Sequences

Top

Fusion Protein Sequence for BCL2L2_CAPN8

check button In-frame Fusion Protein Sequences.
>BCL2L2_CAPN8_ENST00000250405_ENST00000366872_23777408_223718212 length=388nt
MDNGLVEPIPIIKMSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNW
GRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLVEH
RGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTVYGHAGSCTGFLYRNSSCWRSDDRFNSKVASLGTAI


check button N-Truncated Protein (5UTR-3CDS) Sequences

check button C-Truncated Protein (5CDS-3UTR) Sequences

Top

Personalized Fusion Protein Sequence for BCL2L2_CAPN8


check button TCGA Kinase/DNA-binding Domain Mutated Fusion Protein Sequences
NumGene GroupDomain LociFusion Protein IDFusion Gene NamePartnerMutated Residue in WT ProteinSeq. LengthMutated Residue in Fusion Protein

check button CCLE Kinase/DNA-binding Domain Mutated Fusion Protein Sequences

NumGene GroupDomain LociFusion Protein IDFusion Gene NamePartnerMutated Residue in WT ProteinSeq. LengthMutated Residue in Fusion Protein

check button TCGA All Mutated Fusion Protein Sequences


Fusion Protein IDSample IDMutated PartnerAAchange in WTSeq. LengthAAchange in Fusion

check button CCLE All Mutated Fusion Protein Sequences


Fusion Protein IDSample IDMutated PartnerAAchange in WTSeq. LengthAAchange in Fusion

Top

Fusion Gene Exprssed Samples for BCL2L2_CAPN8


check buttonRNA-seq based fusion gene expressed samples.
SourceStudyDiseaseSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChimerDBSTADTCGA-VQ-A8PDBCL2L2

chr14

23777408+CAPN8

chr1

223718212

-

check buttonDNA-seq based fusion gene expressed samples.
SourceStudyDiseaseSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrandSV type


Top

Related Drugs for BCL2L2_CAPN8


check button PubMed Abstract Search With ['A-B' AND 'drug'], ['A::B' AND 'drug']
* For more details on the Studied, Reported, Approved Drugs targeting this fusion gene, Go to FusionPub.
PMIDFusion Gene NameDrugStudy Title

check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.8 2021-05-08)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status