![]() |
||||||
|
![]() | Fusion Gene Summary |
![]() | Fusion Gene ORF analysis |
![]() | Fusion Genomic Features |
![]() | Fusion Protein Features |
![]() | Fusion Gene Sequence |
![]() | Fusion Gene PPI analysis |
![]() | Related Drugs |
![]() | Related Diseases |
Fusion gene:ALDH2-CLIC1 (FusionGDB2 ID:HG217TG1192) |
Fusion Gene Summary for ALDH2-CLIC1 |
![]() |
Fusion gene information | Fusion gene name: ALDH2-CLIC1 | Fusion gene ID: hg217tg1192 | Hgene | Tgene | Gene symbol | ALDH2 | CLIC1 | Gene ID | 217 | 1192 |
Gene name | aldehyde dehydrogenase 2 family member | chloride intracellular channel 1 | |
Synonyms | ALDH-E2|ALDHI|ALDM | CL1C1|CLCNL1|G6|NCC27 | |
Cytomap | ('ALDH2')('CLIC1') 12q24.12 | 6p21.33 | |
Type of gene | protein-coding | protein-coding | |
Description | aldehyde dehydrogenase, mitochondrialALDH class 2acetaldehyde dehydrogenase 2aldehyde dehydrogenase 2 family (mitochondrial)epididymis secretory sperm binding proteinliver mitochondrial ALDHnucleus-encoded mitochondrial aldehyde dehydrogenase 2 | chloride intracellular channel protein 1RNCC proteinchloride channel ABPhRNCCnuclear chloride ion channel 27nuclear chloride ion channel proteinp64CLCPregulatory nuclear chloride ion channel protein | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | P05091 | . | |
Ensembl transtripts involved in fusion gene | ENST00000261733, ENST00000416293, | ||
Fusion gene scores | * DoF score | 26 X 20 X 11=5720 | 8 X 10 X 4=320 |
# samples | 21 | 9 | |
** MAII score | log2(21/5720*10)=-4.76755391399963 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(9/320*10)=-1.83007499855769 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: ALDH2 [Title/Abstract] AND CLIC1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | ALDH2(112221082)-CLIC1(31698653), # samples:3 | ||
Anticipated loss of major functional domain due to fusion event. | ALDH2-CLIC1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ALDH2-CLIC1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ALDH2-CLIC1 seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. ALDH2-CLIC1 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. ALDH2-CLIC1 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Tgene | CLIC1 | GO:0006821 | chloride transport | 9139710 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | COAD | TCGA-AA-A03F-01A | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
ChimerDB4 | COAD | TCGA-AZ-4681-01A | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
ChimerDB4 | READ | TCGA-AG-3728 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
Top |
Fusion Gene ORF analysis for ALDH2-CLIC1 |
![]() * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-intron | ENST00000261733 | ENST00000383404 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000383405 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000400052 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000400058 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000415179 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000418285 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000420458 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000422167 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000423055 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000423143 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000423804 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000425464 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000431921 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000433916 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000434202 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000435242 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000438708 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000438750 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000442045 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000447338 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000447369 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000451546 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000456863 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
5CDS-intron | ENST00000261733 | ENST00000457485 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
Frame-shift | ENST00000261733 | ENST00000375779 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
Frame-shift | ENST00000261733 | ENST00000375784 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
In-frame | ENST00000261733 | ENST00000375780 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
In-frame | ENST00000261733 | ENST00000395892 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-3CDS | ENST00000416293 | ENST00000375779 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-3CDS | ENST00000416293 | ENST00000375780 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-3CDS | ENST00000416293 | ENST00000375784 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-3CDS | ENST00000416293 | ENST00000395892 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000383404 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000383405 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000400052 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000400058 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000415179 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000418285 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000420458 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000422167 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000423055 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000423143 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000423804 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000425464 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000431921 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000433916 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000434202 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000435242 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000438708 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000438750 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000442045 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000447338 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000447369 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000451546 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000456863 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
intron-intron | ENST00000416293 | ENST00000457485 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000261733 | ALDH2 | chr12 | 112221082 | + | ENST00000375780 | CLIC1 | chr6 | 31698653 | - | 596 | 300 | 294 | 593 | 100 |
ENST00000261733 | ALDH2 | chr12 | 112221082 | + | ENST00000395892 | CLIC1 | chr6 | 31698653 | - | 596 | 300 | 294 | 593 | 100 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000261733 | ENST00000375780 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - | 0.5937613 | 0.4062387 |
ENST00000261733 | ENST00000395892 | ALDH2 | chr12 | 112221082 | + | CLIC1 | chr6 | 31698653 | - | 0.5937613 | 0.4062387 |
Top |
Fusion Genomic Features for ALDH2-CLIC1 |
![]() |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
![]() |
![]() |
Top |
Fusion Protein Features for ALDH2-CLIC1 |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr12:112221082/chr6:31698653) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
ALDH2 | . |
FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. |
![]() * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000375779 | 0 | 7 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000375780 | 0 | 7 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000375784 | 0 | 6 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000383404 | 0 | 7 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000383405 | 0 | 7 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000395892 | 0 | 8 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000400052 | 0 | 6 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000400058 | 0 | 8 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000415179 | 0 | 8 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000418285 | 0 | 6 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000420458 | 0 | 7 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000422167 | 0 | 6 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000423055 | 0 | 7 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000423143 | 0 | 7 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000423804 | 0 | 7 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000425464 | 0 | 6 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000431921 | 0 | 7 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000433916 | 0 | 8 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000434202 | 0 | 7 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000435242 | 0 | 8 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000438708 | 0 | 7 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000438750 | 0 | 7 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000442045 | 0 | 7 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000447338 | 0 | 8 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000447369 | 0 | 7 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000451546 | 0 | 8 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000456863 | 0 | 6 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000457485 | 0 | 6 | 93_233 | 0 | 242.0 | Domain | Note=GST C-terminal | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000375779 | 0 | 7 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000375780 | 0 | 7 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000375784 | 0 | 6 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000383404 | 0 | 7 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000383405 | 0 | 7 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000395892 | 0 | 8 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000400052 | 0 | 6 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000400058 | 0 | 8 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000415179 | 0 | 8 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000418285 | 0 | 6 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000420458 | 0 | 7 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000422167 | 0 | 6 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000423055 | 0 | 7 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000423143 | 0 | 7 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000423804 | 0 | 7 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000425464 | 0 | 6 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000431921 | 0 | 7 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000433916 | 0 | 8 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000434202 | 0 | 7 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000435242 | 0 | 8 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000438708 | 0 | 7 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000438750 | 0 | 7 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000442045 | 0 | 7 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000447338 | 0 | 8 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000447369 | 0 | 7 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000451546 | 0 | 8 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000456863 | 0 | 6 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000457485 | 0 | 6 | 2_90 | 0 | 242.0 | Region | Note=Required for insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000375779 | 0 | 7 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000375780 | 0 | 7 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000375784 | 0 | 6 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000383404 | 0 | 7 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000383405 | 0 | 7 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000395892 | 0 | 8 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000400052 | 0 | 6 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000400058 | 0 | 8 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000415179 | 0 | 8 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000418285 | 0 | 6 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000420458 | 0 | 7 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000422167 | 0 | 6 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000423055 | 0 | 7 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000423143 | 0 | 7 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000423804 | 0 | 7 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000425464 | 0 | 6 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000431921 | 0 | 7 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000433916 | 0 | 8 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000434202 | 0 | 7 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000435242 | 0 | 8 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000438708 | 0 | 7 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000438750 | 0 | 7 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000442045 | 0 | 7 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000447338 | 0 | 8 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000447369 | 0 | 7 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000451546 | 0 | 8 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000456863 | 0 | 6 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane | |
Tgene | CLIC1 | chr12:112221082 | chr6:31698653 | ENST00000457485 | 0 | 6 | 26_46 | 0 | 242.0 | Transmembrane | Helical%3B Note%3DAfter insertion into the membrane |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ALDH2 | chr12:112221082 | chr6:31698653 | ENST00000261733 | + | 1 | 13 | 262_267 | 0 | 518.0 | Nucleotide binding | NAD |
Hgene | ALDH2 | chr12:112221082 | chr6:31698653 | ENST00000416293 | + | 1 | 12 | 262_267 | 0 | 471.0 | Nucleotide binding | NAD |
Top |
Fusion Gene Sequence for ALDH2-CLIC1 |
![]() |
>3868_3868_1_ALDH2-CLIC1_ALDH2_chr12_112221082_ENST00000261733_CLIC1_chr6_31698653_ENST00000375780_length(transcript)=596nt_BP=300nt TCAGTGGCCCTGAGACCCTAGCTCTGCTCTCGGTCCGCTCGCTGTCCGCTAGCCCGCTGCGATGTTGCGCGCTGCCGCCCGCTTCGGGCC CCGCCTGGGCCGCCGCCTCTTGTCAGCCGCCGCCACCCAGGCCGTGCCTGCCCCCAACCAGCAGCCCGAGGTCTTCTGCAACCAGATTTT CATAAACAATGAATGGCACGATGCCGTCAGCAGGAAAACATTCCCCACCGTCAATCCGTCCACTGGAGAGGTCATCTGTCAGGTAGCTGA AGGGGACAAGGGGACCGGACCTACCTGGCGTCGCCTATGAGCAAGTGGCAAAGGCCCTCAAATAAGCCCCTCCTGGGACTCCCTCAACCC CCTCCATTTTCTCCACAAAGGCCCTGGTGGTTTCCACATTGCTACCCAATGGACACACTCCAAAATGGCCAGTGGGCAGGGAATCCTGGA GCACTTGTTCCGGGATGGTGTGGTGGAAGAGGGGATGAGGGAAAGAAATGGGGGGCCTGGGTCAGATTTTTATTGTGGGGTGGGATGAGT >3868_3868_1_ALDH2-CLIC1_ALDH2_chr12_112221082_ENST00000261733_CLIC1_chr6_31698653_ENST00000375780_length(amino acids)=100AA_BP=2 MASPMSKWQRPSNKPLLGLPQPPPFSPQRPWWFPHCYPMDTLQNGQWAGNPGALVPGWCGGRGDEGKKWGAWVRFLLWGGMSRTTYFSNK -------------------------------------------------------------- >3868_3868_2_ALDH2-CLIC1_ALDH2_chr12_112221082_ENST00000261733_CLIC1_chr6_31698653_ENST00000395892_length(transcript)=596nt_BP=300nt TCAGTGGCCCTGAGACCCTAGCTCTGCTCTCGGTCCGCTCGCTGTCCGCTAGCCCGCTGCGATGTTGCGCGCTGCCGCCCGCTTCGGGCC CCGCCTGGGCCGCCGCCTCTTGTCAGCCGCCGCCACCCAGGCCGTGCCTGCCCCCAACCAGCAGCCCGAGGTCTTCTGCAACCAGATTTT CATAAACAATGAATGGCACGATGCCGTCAGCAGGAAAACATTCCCCACCGTCAATCCGTCCACTGGAGAGGTCATCTGTCAGGTAGCTGA AGGGGACAAGGGGACCGGACCTACCTGGCGTCGCCTATGAGCAAGTGGCAAAGGCCCTCAAATAAGCCCCTCCTGGGACTCCCTCAACCC CCTCCATTTTCTCCACAAAGGCCCTGGTGGTTTCCACATTGCTACCCAATGGACACACTCCAAAATGGCCAGTGGGCAGGGAATCCTGGA GCACTTGTTCCGGGATGGTGTGGTGGAAGAGGGGATGAGGGAAAGAAATGGGGGGCCTGGGTCAGATTTTTATTGTGGGGTGGGATGAGT >3868_3868_2_ALDH2-CLIC1_ALDH2_chr12_112221082_ENST00000261733_CLIC1_chr6_31698653_ENST00000395892_length(amino acids)=100AA_BP=2 MASPMSKWQRPSNKPLLGLPQPPPFSPQRPWWFPHCYPMDTLQNGQWAGNPGALVPGWCGGRGDEGKKWGAWVRFLLWGGMSRTTYFSNK -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for ALDH2-CLIC1 |
![]() |
![]() |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for ALDH2-CLIC1 |
![]() (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Hgene | ALDH2 | P05091 | DB00536 | Guanidine | Inhibitor | Small molecule | Approved |
Hgene | ALDH2 | P05091 | DB00536 | Guanidine | Inhibitor | Small molecule | Approved |
Hgene | ALDH2 | P05091 | DB00822 | Disulfiram | Inhibitor | Small molecule | Approved |
Hgene | ALDH2 | P05091 | DB00822 | Disulfiram | Inhibitor | Small molecule | Approved |
Hgene | ALDH2 | P05091 | DB00157 | NADH | Small molecule | Approved|Nutraceutical | |
Hgene | ALDH2 | P05091 | DB00157 | NADH | Small molecule | Approved|Nutraceutical |
Top |
Related Diseases for ALDH2-CLIC1 |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | ALDH2 | C0001973 | Alcoholic Intoxication, Chronic | 7 | CTD_human;PSYGENET |
Hgene | ALDH2 | C0085762 | Alcohol abuse | 7 | CTD_human;PSYGENET |
Hgene | ALDH2 | C0001969 | Alcoholic Intoxication | 5 | PSYGENET |
Hgene | ALDH2 | C0393756 | Hangover from alcohol | 4 | PSYGENET |
Hgene | ALDH2 | C0236664 | Alcohol-Related Disorders | 3 | PSYGENET |
Hgene | ALDH2 | C0001956 | Alcohol Use Disorder | 2 | CTD_human |
Hgene | ALDH2 | C0004096 | Asthma | 2 | CTD_human |
Hgene | ALDH2 | C0005586 | Bipolar Disorder | 2 | PSYGENET |
Hgene | ALDH2 | C0279626 | Squamous cell carcinoma of esophagus | 2 | CTD_human |
Hgene | ALDH2 | C0009402 | Colorectal Carcinoma | 1 | CTD_human |
Hgene | ALDH2 | C0009404 | Colorectal Neoplasms | 1 | CTD_human |
Hgene | ALDH2 | C0014859 | Esophageal Neoplasms | 1 | CTD_human |
Hgene | ALDH2 | C0016382 | Flushing | 1 | CTD_human |
Hgene | ALDH2 | C0016689 | Freckles | 1 | CTD_human |
Hgene | ALDH2 | C0021364 | Male infertility | 1 | CTD_human |
Hgene | ALDH2 | C0023893 | Liver Cirrhosis, Experimental | 1 | CTD_human |
Hgene | ALDH2 | C0025209 | Melanosis | 1 | CTD_human |
Hgene | ALDH2 | C0025218 | Chloasma | 1 | CTD_human |
Hgene | ALDH2 | C0028796 | Dermatitis, Occupational | 1 | CTD_human |
Hgene | ALDH2 | C0032927 | Precancerous Conditions | 1 | CTD_human |
Hgene | ALDH2 | C0042373 | Vascular Diseases | 1 | CTD_human |
Hgene | ALDH2 | C0086457 | Industrial Dermatosis | 1 | CTD_human |
Hgene | ALDH2 | C0236970 | Alcohol-Induced Disorders | 1 | CTD_human |
Hgene | ALDH2 | C0242973 | Ventricular Dysfunction | 1 | CTD_human |
Hgene | ALDH2 | C0282313 | Condition, Preneoplastic | 1 | CTD_human |
Hgene | ALDH2 | C0342257 | Complications of Diabetes Mellitus | 1 | CTD_human |
Hgene | ALDH2 | C0349464 | Wernicke-Korsakoff Syndrome | 1 | PSYGENET |
Hgene | ALDH2 | C0400966 | Non-alcoholic Fatty Liver Disease | 1 | CTD_human |
Hgene | ALDH2 | C0520459 | Necrotizing Enterocolitis | 1 | CTD_human |
Hgene | ALDH2 | C0546837 | Malignant neoplasm of esophagus | 1 | CTD_human |
Hgene | ALDH2 | C0848676 | Subfertility, Male | 1 | CTD_human |
Hgene | ALDH2 | C0917731 | Male sterility | 1 | CTD_human |
Hgene | ALDH2 | C2674838 | ALCOHOL SENSITIVITY, ACUTE | 1 | CTD_human |
Hgene | ALDH2 | C3241937 | Nonalcoholic Steatohepatitis | 1 | CTD_human |
Tgene | C0006142 | Malignant neoplasm of breast | 1 | CTD_human | |
Tgene | C0019693 | HIV Infections | 1 | CTD_human | |
Tgene | C0022548 | Keloid | 1 | CTD_human | |
Tgene | C0023893 | Liver Cirrhosis, Experimental | 1 | CTD_human | |
Tgene | C0027627 | Neoplasm Metastasis | 1 | CTD_human | |
Tgene | C0029408 | Degenerative polyarthritis | 1 | CTD_human | |
Tgene | C0086743 | Osteoarthrosis Deformans | 1 | CTD_human | |
Tgene | C0279626 | Squamous cell carcinoma of esophagus | 1 | CTD_human | |
Tgene | C0678222 | Breast Carcinoma | 1 | CTD_human | |
Tgene | C1257931 | Mammary Neoplasms, Human | 1 | CTD_human | |
Tgene | C1458155 | Mammary Neoplasms | 1 | CTD_human | |
Tgene | C4505456 | HIV Coinfection | 1 | CTD_human | |
Tgene | C4704874 | Mammary Carcinoma, Human | 1 | CTD_human |