|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:ABR-GEMIN4 (FusionGDB2 ID:HG29TG50628) |
Fusion Gene Summary for ABR-GEMIN4 |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: ABR-GEMIN4 | Fusion gene ID: hg29tg50628 | Hgene | Tgene | Gene symbol | ABR | GEMIN4 | Gene ID | 29 | 50628 |
| Gene name | ABR activator of RhoGEF and GTPase | gem nuclear organelle associated protein 4 | |
| Synonyms | MDB | HC56|HCAP1|HHRF-1|NEDMCR|p97 | |
| Cytomap | ('ABR')('GEMIN4') 17p13.3 | 17p13.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | active breakpoint cluster region-related proteinABR, RhoGEF and GTPase activating proteinactive BCR-related | gem-associated protein 4HCC-associated protein 1component of gems 4gemin-4 | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q12979 | P57678 | |
| Ensembl transtripts involved in fusion gene | ENST00000291107, ENST00000302538, ENST00000536794, ENST00000544583, ENST00000574437, ENST00000543210, ENST00000572441, ENST00000573895, | ||
| Fusion gene scores | * DoF score | 23 X 15 X 14=4830 | 4 X 1 X 3=12 |
| # samples | 36 | 4 | |
| ** MAII score | log2(36/4830*10)=-3.74595437739346 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(4/12*10)=1.73696559416621 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
| Context | PubMed: ABR [Title/Abstract] AND GEMIN4 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | ABR(953290)-GEMIN4(651272), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | ABR-GEMIN4 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ABR-GEMIN4 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ABR-GEMIN4 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ABR-GEMIN4 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ABR-GEMIN4 seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. ABR-GEMIN4 seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. ABR-GEMIN4 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | ABR | GO:0090630 | activation of GTPase activity | 7479768 |
| Tgene | GEMIN4 | GO:0000387 | spliceosomal snRNP assembly | 18984161 |
| Fusion gene breakpoints across ABR (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across GEMIN4 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene information * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | PRAD | TCGA-HI-7171-01A | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
Top |
Fusion Gene ORF analysis for ABR-GEMIN4 |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| 5CDS-5UTR | ENST00000291107 | ENST00000576778 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| 5CDS-5UTR | ENST00000302538 | ENST00000576778 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| 5CDS-5UTR | ENST00000536794 | ENST00000576778 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| 5CDS-5UTR | ENST00000544583 | ENST00000576778 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| 5CDS-5UTR | ENST00000574437 | ENST00000576778 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| Frame-shift | ENST00000291107 | ENST00000319004 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| Frame-shift | ENST00000291107 | ENST00000437269 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| Frame-shift | ENST00000302538 | ENST00000319004 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| Frame-shift | ENST00000302538 | ENST00000437269 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| Frame-shift | ENST00000536794 | ENST00000319004 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| Frame-shift | ENST00000536794 | ENST00000437269 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| Frame-shift | ENST00000544583 | ENST00000319004 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| Frame-shift | ENST00000574437 | ENST00000319004 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| Frame-shift | ENST00000574437 | ENST00000437269 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| In-frame | ENST00000544583 | ENST00000437269 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| intron-3CDS | ENST00000543210 | ENST00000319004 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| intron-3CDS | ENST00000543210 | ENST00000437269 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| intron-3CDS | ENST00000572441 | ENST00000319004 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| intron-3CDS | ENST00000572441 | ENST00000437269 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| intron-3CDS | ENST00000573895 | ENST00000319004 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| intron-3CDS | ENST00000573895 | ENST00000437269 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| intron-5UTR | ENST00000543210 | ENST00000576778 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| intron-5UTR | ENST00000572441 | ENST00000576778 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| intron-5UTR | ENST00000573895 | ENST00000576778 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000544583 | ABR | chr17 | 953290 | - | ENST00000437269 | GEMIN4 | chr17 | 651272 | - | 3393 | 2253 | 600 | 2261 | 553 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000544583 | ENST00000437269 | ABR | chr17 | 953290 | - | GEMIN4 | chr17 | 651272 | - | 0.009619551 | 0.9903805 |
Top |
Fusion Genomic Features for ABR-GEMIN4 |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
 |
Top |
Fusion Protein Features for ABR-GEMIN4 |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr17:953290/chr17:651272) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| ABR | GEMIN4 |
| FUNCTION: Protein with a unique structure having two opposing regulatory activities toward small GTP-binding proteins. The C-terminus is a GTPase-activating protein domain which stimulates GTP hydrolysis by RAC1, RAC2 and CDC42. Accelerates the intrinsic rate of GTP hydrolysis of RAC1 or CDC42, leading to down-regulation of the active GTP-bound form (PubMed:7479768, PubMed:17116687). The central Dbl homology (DH) domain functions as guanine nucleotide exchange factor (GEF) that modulates the GTPases CDC42, RHOA and RAC1. Promotes the conversion of CDC42, RHOA and RAC1 from the GDP-bound to the GTP-bound form (PubMed:7479768). Functions as an important negative regulator of neuronal RAC1 activity (By similarity). Regulates macrophage functions such as CSF-1 directed motility and phagocytosis through the modulation of RAC1 activity (By similarity). {ECO:0000250|UniProtKB:Q5SSL4, ECO:0000269|PubMed:17116687, ECO:0000269|PubMed:7479768}. | FUNCTION: The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP. In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. Dissociation by the SMN complex of CLNS1A from the trapped Sm proteins and their transfer to an SMN-Sm complex triggers the assembly of core snRNPs and their transport to the nucleus. {ECO:0000269|PubMed:18984161}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000291107 | - | 15 | 22 | 417_420 | 560 | 823.0 | Compositional bias | Note=Poly-Leu |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000302538 | - | 16 | 23 | 417_420 | 597 | 860.0 | Compositional bias | Note=Poly-Leu |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000544583 | - | 16 | 23 | 417_420 | 551 | 814.0 | Compositional bias | Note=Poly-Leu |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000574437 | - | 15 | 22 | 417_420 | 551 | 814.0 | Compositional bias | Note=Poly-Leu |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000291107 | - | 15 | 22 | 301_459 | 560 | 823.0 | Domain | PH |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000291107 | - | 15 | 22 | 91_284 | 560 | 823.0 | Domain | DH |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000302538 | - | 16 | 23 | 301_459 | 597 | 860.0 | Domain | PH |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000302538 | - | 16 | 23 | 91_284 | 597 | 860.0 | Domain | DH |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000544583 | - | 16 | 23 | 301_459 | 551 | 814.0 | Domain | PH |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000544583 | - | 16 | 23 | 91_284 | 551 | 814.0 | Domain | DH |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000574437 | - | 15 | 22 | 301_459 | 551 | 814.0 | Domain | PH |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000574437 | - | 15 | 22 | 91_284 | 551 | 814.0 | Domain | DH |
| Tgene | GEMIN4 | chr17:953290 | chr17:651272 | ENST00000319004 | 0 | 2 | 714_735 | 3 | 1059.0 | Region | Leucine-zipper |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000543210 | - | 1 | 8 | 417_420 | 0 | 311.0 | Compositional bias | Note=Poly-Leu |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000291107 | - | 15 | 22 | 484_613 | 560 | 823.0 | Domain | C2 |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000291107 | - | 15 | 22 | 647_845 | 560 | 823.0 | Domain | Rho-GAP |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000302538 | - | 16 | 23 | 484_613 | 597 | 860.0 | Domain | C2 |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000302538 | - | 16 | 23 | 647_845 | 597 | 860.0 | Domain | Rho-GAP |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000543210 | - | 1 | 8 | 301_459 | 0 | 311.0 | Domain | PH |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000543210 | - | 1 | 8 | 484_613 | 0 | 311.0 | Domain | C2 |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000543210 | - | 1 | 8 | 647_845 | 0 | 311.0 | Domain | Rho-GAP |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000543210 | - | 1 | 8 | 91_284 | 0 | 311.0 | Domain | DH |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000544583 | - | 16 | 23 | 484_613 | 551 | 814.0 | Domain | C2 |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000544583 | - | 16 | 23 | 647_845 | 551 | 814.0 | Domain | Rho-GAP |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000574437 | - | 15 | 22 | 484_613 | 551 | 814.0 | Domain | C2 |
| Hgene | ABR | chr17:953290 | chr17:651272 | ENST00000574437 | - | 15 | 22 | 647_845 | 551 | 814.0 | Domain | Rho-GAP |
Top |
Fusion Gene Sequence for ABR-GEMIN4 |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >551_551_1_ABR-GEMIN4_ABR_chr17_953290_ENST00000544583_GEMIN4_chr17_651272_ENST00000437269_length(transcript)=3393nt_BP=2253nt GGACTGCAGAGGGAACTTGCCTTGAAGAGGCCTGGTCCTTAAAGAGACACAGCACACACGGCCCGACCGGCAGCCCCAGAGCAGAGGCTC CACTGATGGCAGGCGCCCCTGGCTAGGCTCTGAGGTTCCTTTGCCCTCGCCTTGCTGAATGGTGAGCCGCTGCCTCTCGGAGCCCGTCTC CTTGACAGCCTGCCCTCGGCTCCTGCAGCCACTCCTGGGCCTGATGGGGACAGGGCCAGCCTGGTGGGTGGTGTCAGAGGTCCTGGCAGA GCAGCGTAGGCCTGGGATGCGTCTGCAGAATTCTGGCTGAACGAGCGAGGAGCACGGCCAGCTTCGGGGCCGTCGTGACCACAGGAGGGC AGAGGGCCAGCCCGTGAGCTCTGACCCCAGCTGGACGTGCTCTTGTTTCCCTTGGGGCTAAGGAGATTGGAGCCACTGAACTGAATCTCT GGGTTTTGGAGACTTAGAGAATCCATTGGACTCTTCTGCTGGCGTCTTTCTGAATGCTGATGGGGACTTGGTGACTTCAGCTACGGGACG GACGAGTACGACGGAGAGGGGAATGAGGAGCAGAAGGGGCCCCCGGAGGGCTCAGAGACCATGCCGTACATCGATGAGTCGCCCACCATG TCCCCGCAGCTCAGCGCCCGCAGCCAGGGCGGGGGGGATGGCGTCTCCCCGACTCCACCTGAGGGACTGGCTCCTGGGGTGGAAGCAGGG AAAGGCCTGGAGATGAGGAAGCTGGTTCTCTCGGGGTTCTTGGCCAGCGAAGAGATCTACATTAACCAGCTGGAAGCCCTGTTGCTGCCC ATGAAACCCCTGAAGGCCACCGCCACCACCTCCCAGCCCGTGCTCACCATCCAGCAGATCGAGACCATCTTCTACAAGATCCAGGACATC TATGAGATCCACAAGGAGTTCTATGACAACCTGTGCCCCAAGGTGCAACAGTGGGACAGCCAGGTCACCATGGGCCACCTCTTCCAGAAG CTGGCCAGCCAGCTCGGTGTGTACAAAGCGTTTGTCGATAACTATAAAGTCGCTCTGGAGACAGCTGAGAAGTGCAGCCAGTCCAACAAC CAGTTCCAGAAGATCTCAGAGGAACTCAAAGTGAAAGGTCCCAAGGACTCCAAGGACAGCCACACGTCTGTCACCATGGAAGCTCTGCTC TACAAGCCCATTGACCGGGTCACTCGGAGCACCCTAGTCCTACACGACCTGCTGAAGCACACACCTGTGGACCACCCCGACTACCCGCTG CTGCAGGATGCCCTCCGCATCTCCCAGAACTTCCTGTCCAGCATCAACGAGGACATCGACCCCCGCCGGACTGCAGTGACAACGCCCAAG GGGGAGACGCGACAGCTGGTGAAGGACGGCTTCCTGGTGGAAGTGTCAGAGAGCTCCCGGAAGCTGCGGCACGTCTTCCTCTTTACAGAT GTCCTACTGTGTGCCAAGCTGAAGAAGACCTCTGCAGGGAAGCACCAGCAGTATGACTGTAAGTGGTACATCCCCCTGGCCGACCTGGTG TTTCCATCCCCCGAGGAGTCTGAGGCCAGCCCCCAGGTGCACCCCTTCCCAGACCATGAGCTGGAGGACATGAAGATGAAGATCTCTGCC CTCAAGAGTGAAATCCAGAAGGAGAAAGCCAACAAAGGCCAGAGCCGGGCCATCGAGCGCCTGAAGAAGAAGATGTTTGAGAATGAGTTC CTGCTGCTGCTCAACTCCCCCACAATCCCGTTCAGGATCCACAATCGGAATGGAAAGAGTTACCTGTTCCTACTGTCCTCGGACTACGAG AGGTCAGAGTGGAGAGAAGCAATTCAGAAACTACAGAAGAAGGATCTCCAGGCCTTTGTCCTGAGCTCAGTGGAGCTCCAGGTGCTCACA GGATCCTGTTTCAAGCTTAGGACTGTACACAACATTCCTGTCACCAGCAATAAAGACGACGATGAGTCTCCAGGACTCTATGGCTTCCTT CATGTCATCGTCCACTCTGCCAAGGGATTTAAGCAATCAGCCAACCTGTACTGTACCCTGGAGGTGGATTCCTTCGGCTATTTTGTCAGC AAAGCCAAAACCAGGGTGTTCCGGGACACAGCGGAGCCCAAGTGGGATGAGGAGTTTGAGATCGAGCTGGAGGGCTCCCAGTCCCTGAGG ATCCTGTGCTATGAGAAGTGCTATGACAAGACCAAGGTCAACAAGGACAACAATGAGATCGTGGACAAGATCATGGGCAAAGGACAGATC CAGGACCCTTGAACATCTGTGAAGAAATGACTATTCTGCATGGAGGCTTCTTGCTGGCCGAGCAGCTGTTCCACCCTAAGGCACTGGCAG AATTAACAAAGTCTGACTGGGAACGTGTTGGACGGCCCATCGTGGAGGCCTTAAGGGAGATCTCCTCGGCTGCAGCACACTCCCAGCCCT TTGCCTGGAAGAAGAAAGCCCTGATCATCATCTGGGCCAAGGTTCTGCAGCCGCACCCCGTGACCCCGTCCGACACAGAGACACGGTGGC AGGAAGACCTGTTCTTCTCGGTGGGCAACATGATCCCCACCATCAACCACACCATCCTCTTCGAGCTGCTCAAATCCCTGGAAGCTTCTG GACTCTTTATCCAGCTCCTGATGGCCCTGCCCACCACCATCTGCCATGCAGAACTAGAGCGCTTTCTGGAACATGTGACCGTTGACACTT CTGCCGAAGACGTGGCCTTCTTCCTGGACGTCTGGTGGGAGAGGACGACCCCCAGGAGGTGTCTGCAACCGTGTATCTGGACAAACTGGC CACGGTGATCTCTGTGTGGAACTCGGACACCCAGAATCCCTACCACCAGCAGGCGCTGGCAGAGAAGGTGAAGGAGGCAGAACGGGATGT CAGCCTGACCTCGCTGGCCAAACTCCCCAGTGAGACCATTTTCGTGGGCTGCGAGTTCCTGCACCACCTGCTGCGGGAGTGGGGGGAGGA GTTGCAGGCCGTGCTCCGCAGCAGCCAGGGGACAAGTTACGACAGCTACCGGCTGTGCGACAGTCTGACTTCCTTCAGCCAGAACGCGAC GCTCTACCTGAACCGCACCAGCCTGTCCAAGGAGGACAGGCAGGTGGTCTCTGAGCTGGCGGAGTGTGTCAGGGACTTCCTGAGGAAAAC GAGCACGGTGCTGAAGAACAGGGCCTTGGAGGATATCACAGCTTCCATTGCCATGGCCGTCATCCAGCAGAAGATGGACCGCCATATGGA AGTGTGCTACATTTTTGCCTCTGAGAAGAAGTGGGCCTTCTCGGACGAGTGGGTAGCCTGCCTGGGGAGTAACAGGGCCCTCTTCCGACA >551_551_1_ABR-GEMIN4_ABR_chr17_953290_ENST00000544583_GEMIN4_chr17_651272_ENST00000437269_length(amino acids)=553AA_BP= MPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATATTSQPVLTIQQI ETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDS HTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKDGFLVEVSESSR KLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIER LKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDD DESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCYEKCYDKTKVNKDNNEI -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for ABR-GEMIN4 |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for ABR-GEMIN4 |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for ABR-GEMIN4 |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Hgene | ABR | C0033578 | Prostatic Neoplasms | 1 | CTD_human |
| Hgene | ABR | C0376358 | Malignant neoplasm of prostate | 1 | CTD_human |
| Tgene | C4693567 | NEURODEVELOPMENTAL DISORDER WITH MICROCEPHALY, CATARACTS, AND RENAL ABNORMALITIES | 3 | GENOMICS_ENGLAND;UNIPROT | |
| Tgene | C0001973 | Alcoholic Intoxication, Chronic | 1 | PSYGENET |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies