|
||||||
|
 | Fusion Gene Summary |
| Fusion Gene ORF analysis |
| Fusion Genomic Features |
| Fusion Protein Features |
| Fusion Gene Sequence |
| Fusion Gene PPI analysis |
| Related Drugs |
| Related Diseases |
Fusion gene:ARGLU1-CXCR4 (FusionGDB2 ID:HG55082TG7852) |
Fusion Gene Summary for ARGLU1-CXCR4 |
 Fusion gene summary |
| Fusion gene information | Fusion gene name: ARGLU1-CXCR4 | Fusion gene ID: hg55082tg7852 | Hgene | Tgene | Gene symbol | ARGLU1 | CXCR4 | Gene ID | 55082 | 7852 |
| Gene name | arginine and glutamate rich 1 | C-X-C motif chemokine receptor 4 | |
| Synonyms | - | CD184|D2S201E|FB22|HM89|HSY3RR|LAP-3|LAP3|LCR1|LESTR|NPY3R|NPYR|NPYRL|NPYY3R|WHIM|WHIMS | |
| Cytomap | ('ARGLU1')('CXCR4') 13q33.3 | 2q22.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | arginine and glutamate-rich protein 1 | C-X-C chemokine receptor type 4CD184 antigenLPS-associated protein 3SDF-1 receptorchemokine (C-X-C motif) receptor 4chemokine receptorfusinleukocyte-derived seven transmembrane domain receptorlipopolysaccharide-associated protein 3neuropeptide Y | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q9NWB6 | P61073 | |
| Ensembl transtripts involved in fusion gene | ENST00000400198, ENST00000375926, ENST00000472226, | ||
| Fusion gene scores | * DoF score | 6 X 6 X 2=72 | 6 X 3 X 4=72 |
| # samples | 6 | 6 | |
| ** MAII score | log2(6/72*10)=-0.263034405833794 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(6/72*10)=-0.263034405833794 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context | PubMed: ARGLU1 [Title/Abstract] AND CXCR4 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint | ARGLU1(107219921)-CXCR4(136873482), # samples:3 | ||
| Anticipated loss of major functional domain due to fusion event. | ARGLU1-CXCR4 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ARGLU1-CXCR4 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ARGLU1-CXCR4 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ARGLU1-CXCR4 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ARGLU1-CXCR4 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. ARGLU1-CXCR4 seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. ARGLU1-CXCR4 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | CXCR4 | GO:0007186 | G protein-coupled receptor signaling pathway | 10644702 |
| Tgene | CXCR4 | GO:0030155 | regulation of cell adhesion | 19703720 |
| Tgene | CXCR4 | GO:0038160 | CXCL12-activated CXCR4 signaling pathway | 28978524 |
| Tgene | CXCR4 | GO:0071345 | cellular response to cytokine stimulus | 21540189 |
| Fusion gene breakpoints across ARGLU1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across CXCR4 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | PRAD | TCGA-KK-A59X-01A | ARGLU1 | chr13 | 107219921 | - | CXCR4 | chr2 | 136873482 | - |
| ChimerDB4 | PRAD | TCGA-KK-A59X | ARGLU1 | chr13 | 107219921 | - | CXCR4 | chr2 | 136873482 | - |
Top |
Fusion Gene ORF analysis for ARGLU1-CXCR4 |
| Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| 5CDS-5UTR | ENST00000400198 | ENST00000466288 | ARGLU1 | chr13 | 107219921 | - | CXCR4 | chr2 | 136873482 | - |
| Frame-shift | ENST00000400198 | ENST00000409817 | ARGLU1 | chr13 | 107219921 | - | CXCR4 | chr2 | 136873482 | - |
| In-frame | ENST00000400198 | ENST00000241393 | ARGLU1 | chr13 | 107219921 | - | CXCR4 | chr2 | 136873482 | - |
| intron-3CDS | ENST00000375926 | ENST00000241393 | ARGLU1 | chr13 | 107219921 | - | CXCR4 | chr2 | 136873482 | - |
| intron-3CDS | ENST00000375926 | ENST00000409817 | ARGLU1 | chr13 | 107219921 | - | CXCR4 | chr2 | 136873482 | - |
| intron-3CDS | ENST00000472226 | ENST00000241393 | ARGLU1 | chr13 | 107219921 | - | CXCR4 | chr2 | 136873482 | - |
| intron-3CDS | ENST00000472226 | ENST00000409817 | ARGLU1 | chr13 | 107219921 | - | CXCR4 | chr2 | 136873482 | - |
| intron-5UTR | ENST00000375926 | ENST00000466288 | ARGLU1 | chr13 | 107219921 | - | CXCR4 | chr2 | 136873482 | - |
| intron-5UTR | ENST00000472226 | ENST00000466288 | ARGLU1 | chr13 | 107219921 | - | CXCR4 | chr2 | 136873482 | - |
| ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000400198 | ARGLU1 | chr13 | 107219921 | - | ENST00000241393 | CXCR4 | chr2 | 136873482 | - | 2154 | 592 | 622 | 1635 | 337 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000400198 | ENST00000241393 | ARGLU1 | chr13 | 107219921 | - | CXCR4 | chr2 | 136873482 | - | 0.01645056 | 0.9835495 |
Top |
Fusion Genomic Features for ARGLU1-CXCR4 |
| FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
| Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
| Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
 |
Top |
Fusion Protein Features for ARGLU1-CXCR4 |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr13:107219921/chr2:136873482) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| ARGLU1 | CXCR4 |
| FUNCTION: Required for the estrogen-dependent expression of ESR1 target genes. Can act in cooperation with MED1. {ECO:0000269|PubMed:21454576}. | FUNCTION: Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation (PubMed:10452968, PubMed:28978524, PubMed:18799424, PubMed:24912431). Involved in the AKT signaling cascade (PubMed:24912431). Plays a role in regulation of cell migration, e.g. during wound healing (PubMed:28978524). Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels (PubMed:20228059). Binds bacterial lipopolysaccharide (LPS) et mediates LPS-induced inflammatory response, including TNF secretion by monocytes (PubMed:11276205). Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival (By similarity). {ECO:0000250|UniProtKB:P70658, ECO:0000269|PubMed:10074102, ECO:0000269|PubMed:10452968, ECO:0000269|PubMed:10644702, ECO:0000269|PubMed:10825158, ECO:0000269|PubMed:11276205, ECO:0000269|PubMed:17197449, ECO:0000269|PubMed:18799424, ECO:0000269|PubMed:20048153, ECO:0000269|PubMed:20228059, ECO:0000269|PubMed:20505072, ECO:0000269|PubMed:24912431, ECO:0000269|PubMed:28978524, ECO:0000269|PubMed:8752280, ECO:0000269|PubMed:8752281}.; FUNCTION: (Microbial infection) Acts as a coreceptor (CD4 being the primary receptor) for human immunodeficiency virus-1/HIV-1 X4 isolates and as a primary receptor for some HIV-2 isolates. Promotes Env-mediated fusion of the virus (PubMed:8849450, PubMed:8929542, PubMed:9427609, PubMed:10074122, PubMed:10756055). {ECO:0000269|PubMed:10074122, ECO:0000269|PubMed:10756055, ECO:0000269|PubMed:8849450, ECO:0000269|PubMed:8929542, ECO:0000269|PubMed:9427609}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - In-frame and retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ARGLU1 | chr13:107219921 | chr2:136873482 | ENST00000400198 | - | 1 | 4 | 3_74 | 115 | 274.0 | Compositional bias | Note=Arg-rich |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 133_135 | 5 | 353.0 | Motif | Note=Important for signaling | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 133_135 | 0 | 357.0 | Motif | Note=Important for signaling | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 113_117 | 5 | 353.0 | Region | Note=Chemokine binding | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 135_147 | 5 | 353.0 | Region | Note=Involved in dimerization%3B when bound to chemokine | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 186_190 | 5 | 353.0 | Region | Note=Chemokine binding%2C important for signaling and HIV-1 coreceptor activity | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 191_210 | 5 | 353.0 | Region | Note=Involved in dimerization | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 266_268 | 5 | 353.0 | Region | Note=Involved in dimerization | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 94_97 | 5 | 353.0 | Region | Chemokine binding | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 113_117 | 0 | 357.0 | Region | Note=Chemokine binding | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 135_147 | 0 | 357.0 | Region | Note=Involved in dimerization%3B when bound to chemokine | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 186_190 | 0 | 357.0 | Region | Note=Chemokine binding%2C important for signaling and HIV-1 coreceptor activity | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 191_210 | 0 | 357.0 | Region | Note=Involved in dimerization | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 1_21 | 0 | 357.0 | Region | Important for chemokine binding%2C signaling and HIV-1 coreceptor activity | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 266_268 | 0 | 357.0 | Region | Note=Involved in dimerization | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 94_97 | 0 | 357.0 | Region | Chemokine binding | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 100_110 | 5 | 353.0 | Topological domain | Extracellular | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 131_154 | 5 | 353.0 | Topological domain | Cytoplasmic | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 175_195 | 5 | 353.0 | Topological domain | Extracellular | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 217_241 | 5 | 353.0 | Topological domain | Cytoplasmic | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 262_282 | 5 | 353.0 | Topological domain | Extracellular | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 303_352 | 5 | 353.0 | Topological domain | Cytoplasmic | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 64_77 | 5 | 353.0 | Topological domain | Cytoplasmic | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 100_110 | 0 | 357.0 | Topological domain | Extracellular | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 131_154 | 0 | 357.0 | Topological domain | Cytoplasmic | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 175_195 | 0 | 357.0 | Topological domain | Extracellular | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 1_38 | 0 | 357.0 | Topological domain | Extracellular | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 217_241 | 0 | 357.0 | Topological domain | Cytoplasmic | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 262_282 | 0 | 357.0 | Topological domain | Extracellular | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 303_352 | 0 | 357.0 | Topological domain | Cytoplasmic | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 64_77 | 0 | 357.0 | Topological domain | Cytoplasmic | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 111_130 | 5 | 353.0 | Transmembrane | Helical%3B Name%3D3 | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 155_174 | 5 | 353.0 | Transmembrane | Helical%3B Name%3D4 | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 196_216 | 5 | 353.0 | Transmembrane | Helical%3B Name%3D5 | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 242_261 | 5 | 353.0 | Transmembrane | Helical%3B Name%3D6 | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 283_302 | 5 | 353.0 | Transmembrane | Helical%3B Name%3D7 | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 39_63 | 5 | 353.0 | Transmembrane | Helical%3B Name%3D1 | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 78_99 | 5 | 353.0 | Transmembrane | Helical%3B Name%3D2 | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 111_130 | 0 | 357.0 | Transmembrane | Helical%3B Name%3D3 | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 155_174 | 0 | 357.0 | Transmembrane | Helical%3B Name%3D4 | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 196_216 | 0 | 357.0 | Transmembrane | Helical%3B Name%3D5 | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 242_261 | 0 | 357.0 | Transmembrane | Helical%3B Name%3D6 | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 283_302 | 0 | 357.0 | Transmembrane | Helical%3B Name%3D7 | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 39_63 | 0 | 357.0 | Transmembrane | Helical%3B Name%3D1 | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000409817 | 0 | 1 | 78_99 | 0 | 357.0 | Transmembrane | Helical%3B Name%3D2 |
| - In-frame and not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ARGLU1 | chr13:107219921 | chr2:136873482 | ENST00000400198 | - | 1 | 4 | 97_251 | 115 | 274.0 | Compositional bias | Note=Glu-rich |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 1_21 | 5 | 353.0 | Region | Important for chemokine binding%2C signaling and HIV-1 coreceptor activity | |
| Tgene | CXCR4 | chr13:107219921 | chr2:136873482 | ENST00000241393 | 0 | 2 | 1_38 | 5 | 353.0 | Topological domain | Extracellular |
Top |
Fusion Gene Sequence for ARGLU1-CXCR4 |
| For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >5914_5914_1_ARGLU1-CXCR4_ARGLU1_chr13_107219921_ENST00000400198_CXCR4_chr2_136873482_ENST00000241393_length(transcript)=2154nt_BP=592nt ATTGTGGGAAGGGCGGCCGGTGCAGCCGCAGCTGCCATCTTAGGGGCGCCTGGCGCTACGGGTTTCTCGTTGGAGGCGGCCTTCGTGGCA GCTGTAGACGCCGGGAAAAGGCATAAAGTCCGTTGGCCGACACCTTTCTTTCCTCCGGCCTCGGTAGAACCGCCAGCCCGCGTCCGAAGG CGGAGGCGAGGGGAACTGGCCGCGTGAGGGGCCTGAGGCGAGCGGTTAGAGCGTCTCCCGGAAGGATGGGCCGGTCTCGGAGCCGGAGCT CGTCCCGCTCCAAGCACACCAAGAGCAGCAAGCACAACAAGAAGCGCAGCCGGTCCCGGTCGCGATCCCGGGACAAGGAGCGCGTGCGGA AGCGTTCCAAATCTCGGGAAAGTAAACGGAACCGGCGGCGGGAGTCGCGGTCCCGTTCGCGCTCCACCAACACGGCCGTGTCCCGGCGCG AGCGGGACCGGGAGCGCGCCTCGTCCCCGCCCGACCGCATCGACATCTTCGGGCGCACGGTGAGCAAGCGCAGCAGCCTGGACGAGAAGC AGAAGCGAGAGGAGGAGGAGAAGAAAGCGGAGTTCGAGCGGCAGCGAAAAATATATACACTTCAGATAACTACACCGAGGAAATGGGCTC AGGGGACTATGACTCCATGAAGGAACCCTGTTTCCGTGAAGAAAATGCTAATTTCAATAAAATCTTCCTGCCCACCATCTACTCCATCAT CTTCTTAACTGGCATTGTGGGCAATGGATTGGTCATCCTGGTCATGGGTTACCAGAAGAAACTGAGAAGCATGACGGACAAGTACAGGCT GCACCTGTCAGTGGCCGACCTCCTCTTTGTCATCACGCTTCCCTTCTGGGCAGTTGATGCCGTGGCAAACTGGTACTTTGGGAACTTCCT ATGCAAGGCAGTCCATGTCATCTACACAGTCAACCTCTACAGCAGTGTCCTCATCCTGGCCTTCATCAGTCTGGACCGCTACCTGGCCAT CGTCCACGCCACCAACAGTCAGAGGCCAAGGAAGCTGTTGGCTGAAAAGGTGGTCTATGTTGGCGTCTGGATCCCTGCCCTCCTGCTGAC TATTCCCGACTTCATCTTTGCCAACGTCAGTGAGGCAGATGACAGATATATCTGTGACCGCTTCTACCCCAATGACTTGTGGGTGGTTGT GTTCCAGTTTCAGCACATCATGGTTGGCCTTATCCTGCCTGGTATTGTCATCCTGTCCTGCTATTGCATTATCATCTCCAAGCTGTCACA CTCCAAGGGCCACCAGAAGCGCAAGGCCCTCAAGACCACAGTCATCCTCATCCTGGCTTTCTTCGCCTGTTGGCTGCCTTACTACATTGG GATCAGCATCGACTCCTTCATCCTCCTGGAAATCATCAAGCAAGGGTGTGAGTTTGAGAACACTGTGCACAAGTGGATTTCCATCACCGA GGCCCTAGCTTTCTTCCACTGTTGTCTGAACCCCATCCTCTATGCTTTCCTTGGAGCCAAATTTAAAACCTCTGCCCAGCACGCACTCAC CTCTGTGAGCAGAGGGTCCAGCCTCAAGATCCTCTCCAAAGGAAAGCGAGGTGGACATTCATCTGTTTCCACTGAGTCTGAGTCTTCAAG TTTTCACTCCAGCTAACACAGATGTAAAAGACTTTTTTTTATACGATAAATAACTTTTTTTTAAGTTACACATTTTTCAGATATAAAAGA CTGACCAATATTGTACAGTTTTTATTGCTTGTTGGATTTTTGTCTTGTGTTTCTTTAGTTTTTGTGAAGTTTAATTGACTTATTTATATA AATTTTTTTTGTTTCATATTGATGTGTGTCTAGGCAGGACCTGTGGCCAAGTTCTTAGTTGCTGTATGTCTCGTGGTAGGACTGTAGAAA AGGGAACTGAACATTCCAGAGCGTGTAGTGAATCACGTAAAGCTAGAAATGATCCCCAGCTGTTTATGCATAGATAATCTCTCCATTCCC GTGGAACGTTTTTCCTGTTCTTAAGACGTGATTTTGCTGTAGAAGATGGCACTTATAACCAAAGCCCAAAGTGGTATAGAAATGCTGGTT >5914_5914_1_ARGLU1-CXCR4_ARGLU1_chr13_107219921_ENST00000400198_CXCR4_chr2_136873482_ENST00000241393_length(amino acids)=337AA_BP= MGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFG NFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLW VVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWIS -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for ARGLU1-CXCR4 |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
| Hgene | Hgene's interactors | Tgene | Tgene's interactors |
| - Retained PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost PPIs in in-frame fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| - Retained PPIs, but lost function due to frame-shift fusion. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for ARGLU1-CXCR4 |
| Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
| Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
| Tgene | CXCR4 | P61073 | DB00452 | Framycetin | Antagonist | Small molecule | Approved |
| Tgene | CXCR4 | P61073 | DB06809 | Plerixafor | Antagonist | Small molecule | Approved |
| Tgene | CXCR4 | P61073 | DB12698 | Ibalizumab | Antagonist | Biotech | Approved|Investigational |
Top |
Related Diseases for ARGLU1-CXCR4 |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Tgene | C0472817 | WHIM syndrome | 3 | CTD_human;GENOMICS_ENGLAND;ORPHANET | |
| Tgene | C0027627 | Neoplasm Metastasis | 2 | CTD_human | |
| Tgene | C0087031 | Juvenile-Onset Still Disease | 2 | CTD_human | |
| Tgene | C0340970 | Congenital neutropenia | 2 | GENOMICS_ENGLAND | |
| Tgene | C3495559 | Juvenile arthritis | 2 | CTD_human | |
| Tgene | C3714758 | Juvenile psoriatic arthritis | 2 | CTD_human | |
| Tgene | C4552091 | Polyarthritis, Juvenile, Rheumatoid Factor Negative | 2 | CTD_human | |
| Tgene | C4704862 | Polyarthritis, Juvenile, Rheumatoid Factor Positive | 2 | CTD_human | |
| Tgene | C0003873 | Rheumatoid Arthritis | 1 | CTD_human | |
| Tgene | C0006142 | Malignant neoplasm of breast | 1 | CTD_human | |
| Tgene | C0007621 | Neoplastic Cell Transformation | 1 | CTD_human | |
| Tgene | C0027626 | Neoplasm Invasiveness | 1 | CTD_human | |
| Tgene | C0027719 | Nephrosclerosis | 1 | CTD_human | |
| Tgene | C0027796 | Neuralgia | 1 | CTD_human | |
| Tgene | C0038870 | Neuralgia, Supraorbital | 1 | CTD_human | |
| Tgene | C0042656 | Neuralgia, Vidian | 1 | CTD_human | |
| Tgene | C0234247 | Neuralgia, Atypical | 1 | CTD_human | |
| Tgene | C0234249 | Neuralgia, Stump | 1 | CTD_human | |
| Tgene | C0423711 | Neuralgia, Perineal | 1 | CTD_human | |
| Tgene | C0423712 | Neuralgia, Iliohypogastric Nerve | 1 | CTD_human | |
| Tgene | C0678222 | Breast Carcinoma | 1 | CTD_human | |
| Tgene | C0751371 | Neuralgia, Ilioinguinal | 1 | CTD_human | |
| Tgene | C0751372 | Nerve Pain | 1 | CTD_human | |
| Tgene | C0751373 | Paroxysmal Nerve Pain | 1 | CTD_human | |
| Tgene | C1257931 | Mammary Neoplasms, Human | 1 | CTD_human | |
| Tgene | C1458155 | Mammary Neoplasms | 1 | CTD_human | |
| Tgene | C1834176 | MYELOKATHEXIS, ISOLATED | 1 | GENOMICS_ENGLAND | |
| Tgene | C4704874 | Mammary Carcinoma, Human | 1 | CTD_human |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies