![]() |
||||||
|
![]() | Fusion Gene Summary |
![]() | Fusion Gene ORF analysis |
![]() | Fusion Genomic Features |
![]() | Fusion Protein Features |
![]() | Fusion Gene Sequence |
![]() | Fusion Gene PPI analysis |
![]() | Related Drugs |
![]() | Related Diseases |
Fusion gene:CDC73-FAM172A (FusionGDB2 ID:HG79577TG83989) |
Fusion Gene Summary for CDC73-FAM172A |
![]() |
Fusion gene information | Fusion gene name: CDC73-FAM172A | Fusion gene ID: hg79577tg83989 | Hgene | Tgene | Gene symbol | CDC73 | FAM172A | Gene ID | 79577 | 83989 |
Gene name | cell division cycle 73 | family with sequence similarity 172 member A | |
Synonyms | C1orf28|FIHP|HPTJT|HRPT1|HRPT2|HYX | C5orf21|Toupee | |
Cytomap | ('CDC73')('FAM172A') 1q31.2 | 5q15 | |
Type of gene | protein-coding | protein-coding | |
Description | parafibrominFamilial isolated hyperparathyroidismPaf1/RNA polymerase II complex componentcell division cycle 73 Paf1/RNA polymerase II complex component-like proteincell division cycle 73, Paf1/RNA polymerase II complex component, homologcell divisio | cotranscriptional regulator FAM172Aprotein FAM172A | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | . | . | |
Ensembl transtripts involved in fusion gene | ENST00000367435, ENST00000477868, | ||
Fusion gene scores | * DoF score | 8 X 6 X 6=288 | 11 X 14 X 6=924 |
# samples | 8 | 23 | |
** MAII score | log2(8/288*10)=-1.84799690655495 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(23/924*10)=-2.00625899047168 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: CDC73 [Title/Abstract] AND FAM172A [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | CDC73(193121574)-FAM172A(92956835), # samples:3 | ||
Anticipated loss of major functional domain due to fusion event. | CDC73-FAM172A seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CDC73-FAM172A seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CDC73-FAM172A seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CDC73-FAM172A seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CDC73-FAM172A seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. CDC73-FAM172A seems lost the major protein functional domain in Hgene partner, which is a epigenetic factor due to the frame-shifted ORF. CDC73-FAM172A seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. CDC73-FAM172A seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. CDC73-FAM172A seems lost the major protein functional domain in Tgene partner, which is a tumor suppressor due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | CDC73 | GO:0008285 | negative regulation of cell proliferation | 16989776 |
Hgene | CDC73 | GO:0010390 | histone monoubiquitination | 16307923 |
Hgene | CDC73 | GO:0030177 | positive regulation of Wnt signaling pathway | 16630820 |
Hgene | CDC73 | GO:0032968 | positive regulation of transcription elongation from RNA polymerase II promoter | 20178742 |
Hgene | CDC73 | GO:0033523 | histone H2B ubiquitination | 16307923 |
Hgene | CDC73 | GO:0045638 | negative regulation of myeloid cell differentiation | 20541477 |
Hgene | CDC73 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 20178742 |
Hgene | CDC73 | GO:2000134 | negative regulation of G1/S transition of mitotic cell cycle | 16989776 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LAML | TCGA-AB-2939-03A | CDC73 | chr1 | 193121574 | - | FAM172A | chr5 | 92956835 | - |
ChimerDB4 | LAML | TCGA-AB-2939_61FFWAAXX_7 | CDC73 | chr1 | 193121574 | + | FAM172A | chr5 | 92956835 | - |
ChimerDB4 | LAML | TCGA-AB-2939 | CDC73 | chr1 | 193121574 | + | FAM172A | chr5 | 92956835 | - |
Top |
Fusion Gene ORF analysis for CDC73-FAM172A |
![]() * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-intron | ENST00000367435 | ENST00000504768 | CDC73 | chr1 | 193121574 | + | FAM172A | chr5 | 92956835 | - |
Frame-shift | ENST00000367435 | ENST00000395965 | CDC73 | chr1 | 193121574 | + | FAM172A | chr5 | 92956835 | - |
Frame-shift | ENST00000367435 | ENST00000505869 | CDC73 | chr1 | 193121574 | + | FAM172A | chr5 | 92956835 | - |
Frame-shift | ENST00000367435 | ENST00000509739 | CDC73 | chr1 | 193121574 | + | FAM172A | chr5 | 92956835 | - |
In-frame | ENST00000367435 | ENST00000509163 | CDC73 | chr1 | 193121574 | + | FAM172A | chr5 | 92956835 | - |
intron-3CDS | ENST00000477868 | ENST00000395965 | CDC73 | chr1 | 193121574 | + | FAM172A | chr5 | 92956835 | - |
intron-3CDS | ENST00000477868 | ENST00000505869 | CDC73 | chr1 | 193121574 | + | FAM172A | chr5 | 92956835 | - |
intron-3CDS | ENST00000477868 | ENST00000509163 | CDC73 | chr1 | 193121574 | + | FAM172A | chr5 | 92956835 | - |
intron-3CDS | ENST00000477868 | ENST00000509739 | CDC73 | chr1 | 193121574 | + | FAM172A | chr5 | 92956835 | - |
intron-intron | ENST00000477868 | ENST00000504768 | CDC73 | chr1 | 193121574 | + | FAM172A | chr5 | 92956835 | - |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000367435 | CDC73 | chr1 | 193121574 | + | ENST00000509163 | FAM172A | chr5 | 92956835 | - | 1357 | 1156 | 7 | 1176 | 389 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000367435 | ENST00000509163 | CDC73 | chr1 | 193121574 | + | FAM172A | chr5 | 92956835 | - | 0.005220167 | 0.9947798 |
Top |
Fusion Genomic Features for CDC73-FAM172A |
![]() |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
![]() |
![]() |
Top |
Fusion Protein Features for CDC73-FAM172A |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:193121574/chr5:92956835) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
. | . |
FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. | FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. |
![]() * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CDC73 | chr1:193121574 | chr5:92956835 | ENST00000367435 | + | 10 | 17 | 125_139 | 324 | 532.0 | Motif | Note=Nuclear localization signal |
Tgene | FAM172A | chr1:193121574 | chr5:92956835 | ENST00000395965 | 9 | 11 | 413_416 | 369 | 417.0 | Motif | Prevents secretion from ER | |
Tgene | FAM172A | chr1:193121574 | chr5:92956835 | ENST00000505869 | 7 | 9 | 413_416 | 259 | 307.0 | Motif | Prevents secretion from ER | |
Tgene | FAM172A | chr1:193121574 | chr5:92956835 | ENST00000509163 | 8 | 10 | 413_416 | 323 | 371.0 | Motif | Prevents secretion from ER |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CDC73 | chr1:193121574 | chr5:92956835 | ENST00000367435 | + | 10 | 17 | 361_364 | 324 | 532.0 | Compositional bias | Note=Poly-Ile |
Top |
Fusion Gene Sequence for CDC73-FAM172A |
![]() |
>14942_14942_1_CDC73-FAM172A_CDC73_chr1_193121574_ENST00000367435_FAM172A_chr5_92956835_ENST00000509163_length(transcript)=1357nt_BP=1156nt CGGCGGCCTGGGTGGCTACTGCCCCTGCTGCTGTCGTAGGCGAGGACGGCTGTTAGTGCTGCTGCTGTTGGTTCGTCGCGGCGGCGAAGG AGGAGGAGGAAGAGGGCGAGGCGACAAGAGAAGAAGGAGGCAGGCGCGGCGGCAGCGGCGGCGCCCCGAGCCGGCGGAGGCGAGGGGGGG GAAGATGGCGGACGTGCTTAGCGTCCTGCGACAGTACAACATCCAGAAGAAGGAGATTGTGGTGAAGGGAGACGAAGTGATCTTCGGGGA GTTCTCCTGGCCCAAGAATGTGAAGACCAACTATGTTGTTTGGGGGACTGGAAAGGAAGGCCAACCCAGAGAGTACTACACATTGGATTC CATTTTATTTCTACTTAATAACGTGCACCTTTCTCATCCTGTTTATGTCCGACGTGCAGCTACTGAAAATATTCCTGTGGTTAGAAGACC TGATCGAAAAGATCTACTTGGATATCTCAATGGTGAAGCGTCAACATCGGCAAGTATAGACAGAAGCGCTCCCTTAGAAATAGGTCTTCA GCGATCTACTCAAGTCAAACGAGCTGCAGATGAAGTTTTAGCAGAAGCAAAGAAACCACGAATTGAGGATGAAGAGTGTGTGCGCCTTGA TAAAGAGAGATTGGCTGCCCGTTTGGAGGGTCACAAAGAAGGGATTGTACAGACTGAACAGATTAGGTCTTTGTCTGAAGCTATGTCAGT GGAAAAAATTGCTGCAATCAAAGCCAAAATTATGGCTAAGAAAAGATCTACTATCAAGACTGATCTAGATGATGACATAACTGCCCTTAA ACAGAGGAGTTTTGTGGATGCTGAGGTAGATGTGACCCGAGATATTGTCAGCAGAGAGAGAGTATGGAGGACACGAACAACTATCTTACA AAGCACAGGAAAGAATTTTTCCAAGAACATTTTTGCAATTCTTCAATCTGTAAAAGCCAGAGAAGAAGGGCGTGCACCTGAACAGCGACC TGCCCCAAATGCAGCACCTGTGGATCCCACTTTGCGCACCAAACAGCCTATCCCAGCTGCCTATAACAGATACGATCAGGAAAGATTCAA AGGAAAAGAAGAAACGGAAGGCTTCAAAATTGACACTATGGGAACCTACCATGGTATGACACTGAAATCTGTAACGGCACCGACCGTCAC GAGCTAACTTCCTGGAAGAGCTTTCCGTCTATTTTCAAATTCTTTACCGAAGCCTCAGAGGCCAAGACCAGCTCCCTGAAGCCGGCTGTG ACGCGCCGCTCCCACCGCATCAAGCACGAAGAGCTGTAAGAGGAGCGAGCGCGACGGGGGAGGCCGCCCTGGCGCACCCACCCGCACGCC TCCTCAC >14942_14942_1_CDC73-FAM172A_CDC73_chr1_193121574_ENST00000367435_FAM172A_chr5_92956835_ENST00000509163_length(amino acids)=389AA_BP= MGGYCPCCCRRRGRLLVLLLLVRRGGEGGGGRGRGDKRRRRQARRQRRRPEPAEARGGKMADVLSVLRQYNIQKKEIVVKGDEVIFGEFS WPKNVKTNYVVWGTGKEGQPREYYTLDSILFLLNNVHLSHPVYVRRAATENIPVVRRPDRKDLLGYLNGEASTSASIDRSAPLEIGLQRS TQVKRAADEVLAEAKKPRIEDEECVRLDKERLAARLEGHKEGIVQTEQIRSLSEAMSVEKIAAIKAKIMAKKRSTIKTDLDDDITALKQR SFVDAEVDVTRDIVSRERVWRTRTTILQSTGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVDPTLRTKQPIPAAYNRYDQERFKGK EETEGFKIDTMGTYHGMTLKSVTAPTVTS -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for CDC73-FAM172A |
![]() |
![]() |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
Hgene | CDC73 | chr1:193121574 | chr5:92956835 | ENST00000367435 | + | 10 | 17 | 200_250 | 324.0 | 532.0 | CTNNB1 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Hgene | CDC73 | chr1:193121574 | chr5:92956835 | ENST00000367435 | + | 10 | 17 | 200_531 | 324.0 | 532.0 | POLR2A and PAF1 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for CDC73-FAM172A |
![]() (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for CDC73-FAM172A |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | CDC73 | C1704981 | Hyperparathyroidism-Jaw Tumor Syndrome | 9 | CLINGEN;CTD_human;GENOMICS_ENGLAND;ORPHANET;UNIPROT |
Hgene | CDC73 | C1840402 | HYPERPARATHYROIDISM 1 | 6 | CTD_human;GENOMICS_ENGLAND;UNIPROT |
Hgene | CDC73 | C0687150 | Parathyroid Gland Adenocarcinoma | 2 | CTD_human;GENOMICS_ENGLAND;ORPHANET |
Hgene | CDC73 | C4551961 | Familial Isolated Hyperparathyroidism | 1 | CTD_human;ORPHANET |