![]() |
||||||
|
![]() | Fusion Gene Summary |
![]() | Fusion Gene ORF analysis |
![]() | Fusion Genomic Features |
![]() | Fusion Protein Features |
![]() | Fusion Gene Sequence |
![]() | Fusion Gene PPI analysis |
![]() | Related Drugs |
![]() | Related Diseases |
Fusion gene:BRD3-LCN2 (FusionGDB2 ID:HG8019TG3934) |
Fusion Gene Summary for BRD3-LCN2 |
![]() |
Fusion gene information | Fusion gene name: BRD3-LCN2 | Fusion gene ID: hg8019tg3934 | Hgene | Tgene | Gene symbol | BRD3 | LCN2 | Gene ID | 8019 | 3934 |
Gene name | bromodomain containing 3 | lipocalin 2 | |
Synonyms | ORFX|RING3L | 24p3|MSFI|NGAL|p25 | |
Cytomap | ('BRD3')('LCN2') 9q34.2 | 9q34.11 | |
Type of gene | protein-coding | protein-coding | |
Description | bromodomain-containing protein 3RING3-like proteinbromodomain-containing protein 3 short isoform | neutrophil gelatinase-associated lipocalin25 kDa alpha-2-microglobulin-related subunit of MMP-9migration-stimulating factor inhibitoroncogene 24p3siderocalin LCN2 | |
Modification date | 20200313 | 20200329 | |
UniProtAcc | . | . | |
Ensembl transtripts involved in fusion gene | ENST00000303407, ENST00000357885, ENST00000371834, ENST00000473349, | ||
Fusion gene scores | * DoF score | 8 X 7 X 4=224 | 11 X 10 X 5=550 |
# samples | 8 | 12 | |
** MAII score | log2(8/224*10)=-1.48542682717024 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(12/550*10)=-2.1963972128035 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: BRD3 [Title/Abstract] AND LCN2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | BRD3(136917427)-LCN2(130912516), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | BRD3-LCN2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. BRD3-LCN2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. BRD3-LCN2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. BRD3-LCN2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. BRD3-LCN2 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. BRD3-LCN2 seems lost the major protein functional domain in Hgene partner, which is a epigenetic factor due to the frame-shifted ORF. BRD3-LCN2 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. BRD3-LCN2 seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | BRD3 | GO:0006357 | regulation of transcription by RNA polymerase II | 18406326 |
Tgene | LCN2 | GO:0042742 | defense response to bacterium | 27780864 |
Tgene | LCN2 | GO:0097577 | sequestering of iron ion | 27780864 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-HU-A4H2 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
Top |
Fusion Gene ORF analysis for BRD3-LCN2 |
![]() * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-intron | ENST00000303407 | ENST00000277480 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000303407 | ENST00000372998 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000303407 | ENST00000373013 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000303407 | ENST00000470902 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000303407 | ENST00000540948 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000357885 | ENST00000277480 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000357885 | ENST00000372998 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000357885 | ENST00000373013 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000357885 | ENST00000470902 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000357885 | ENST00000540948 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000371834 | ENST00000277480 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000371834 | ENST00000372998 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000371834 | ENST00000373013 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000371834 | ENST00000470902 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
5CDS-intron | ENST00000371834 | ENST00000540948 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
Frame-shift | ENST00000303407 | ENST00000373017 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
Frame-shift | ENST00000357885 | ENST00000373017 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
In-frame | ENST00000371834 | ENST00000373017 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
intron-3CDS | ENST00000473349 | ENST00000373017 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
intron-intron | ENST00000473349 | ENST00000277480 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
intron-intron | ENST00000473349 | ENST00000372998 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
intron-intron | ENST00000473349 | ENST00000373013 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
intron-intron | ENST00000473349 | ENST00000470902 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
intron-intron | ENST00000473349 | ENST00000540948 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000371834 | BRD3 | chr9 | 136917427 | - | ENST00000373017 | LCN2 | chr9 | 130912516 | + | 1146 | 673 | 322 | 1131 | 269 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000371834 | ENST00000373017 | BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + | 0.011342038 | 0.988658 |
Top |
Fusion Genomic Features for BRD3-LCN2 |
![]() |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + | 0.9988065 | 0.001193558 |
BRD3 | chr9 | 136917427 | - | LCN2 | chr9 | 130912516 | + | 0.9988065 | 0.001193558 |
![]() |
![]() |
![]() |
![]() |
Top |
Fusion Protein Features for BRD3-LCN2 |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr9:136917427/chr9:130912516) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
. | . |
FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. | FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. |
![]() * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 78_80 | 117 | 727.0 | Region | Acetylated histone H3 binding |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 78_80 | 117 | 557.0 | Region | Acetylated histone H3 binding |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 78_80 | 117 | 557.0 | Region | Acetylated histone H3 binding |
Tgene | LCN2 | chr9:136917427 | chr9:130912516 | ENST00000277480 | 0 | 7 | 72_74 | 46 | 177.0 | Region | Carboxymycobactin binding | |
Tgene | LCN2 | chr9:136917427 | chr9:130912516 | ENST00000373017 | 1 | 7 | 72_74 | 46 | 199.0 | Region | Carboxymycobactin binding | |
Tgene | LCN2 | chr9:136917427 | chr9:130912516 | ENST00000540948 | 0 | 5 | 72_74 | 46 | 199.0 | Region | Carboxymycobactin binding |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 453_524 | 117 | 727.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 645_684 | 117 | 727.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 453_524 | 117 | 557.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 645_684 | 117 | 557.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 453_524 | 117 | 557.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 645_684 | 117 | 557.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 487_555 | 117 | 727.0 | Compositional bias | Note=Lys-rich |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 676_725 | 117 | 727.0 | Compositional bias | Note=Ser-rich |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 487_555 | 117 | 557.0 | Compositional bias | Note=Lys-rich |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 676_725 | 117 | 557.0 | Compositional bias | Note=Ser-rich |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 487_555 | 117 | 557.0 | Compositional bias | Note=Lys-rich |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 676_725 | 117 | 557.0 | Compositional bias | Note=Ser-rich |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 326_398 | 117 | 727.0 | Domain | Bromo 2 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 51_123 | 117 | 727.0 | Domain | Bromo 1 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000303407 | - | 3 | 12 | 562_644 | 117 | 727.0 | Domain | NET |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 326_398 | 117 | 557.0 | Domain | Bromo 2 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 51_123 | 117 | 557.0 | Domain | Bromo 1 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000357885 | - | 3 | 10 | 562_644 | 117 | 557.0 | Domain | NET |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 326_398 | 117 | 557.0 | Domain | Bromo 2 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 51_123 | 117 | 557.0 | Domain | Bromo 1 |
Hgene | BRD3 | chr9:136917427 | chr9:130912516 | ENST00000371834 | - | 3 | 10 | 562_644 | 117 | 557.0 | Domain | NET |
Top |
Fusion Gene Sequence for BRD3-LCN2 |
![]() |
>10182_10182_1_BRD3-LCN2_BRD3_chr9_136917427_ENST00000371834_LCN2_chr9_130912516_ENST00000373017_length(transcript)=1146nt_BP=673nt CCAGGCTAATTAGGCGCGCGGTTTGTTTACAAACACGGGCTCCCGGCAGGTGCGCGCCGCCCCGCCCGTGCGCGGCCGGGGTTCGAGGGT GGCTCCCGCGGGCCTCGGGGTGCCCGGACGGGGGCTGCGGTGCTGGCTGCGTGCCCGCTTCTTCCATGCCGTCCTGGGGCACCGGAAAAT CCGCCGCCAGGCGCTGTCCCCGACACGGGCTGTCGCCTGGTTGGGCCCGGAAATGGGACGTCGCGCTTTCTCAGGGAGCGTAGAAGCAGC CAGGGCCTCTCCAAGCCGCTGCTGTGACAGAAAGTGAGTGAGCTGCCGGAGGATGTCCACCGCCACGACAGTCGCCCCCGCGGGGATCCC GGCGACCCCGGGCCCTGTGAACCCACCCCCCCCGGAGGTCTCCAACCCCAGCAAGCCCGGCCGCAAGACCAACCAGCTGCAGTACATGCA GAATGTGGTGGTGAAGACGCTCTGGAAACACCAGTTCGCCTGGCCCTTCTACCAGCCCGTGGACGCAATCAAATTGAACCTGCCGGATTA TCATAAAATAATTAAAAACCCAATGGATATGGGGACTATTAAGAAGAGACTAGAAAATAATTATTATTGGAGTGCAAGCGAATGTATGCA GGACTTCAACACCATGTTTACAAATTGTTACATTTATAACAAGTTCCAGGGGAAGTGGTATGTGGTAGGCCTGGCAGGGAATGCAATTCT CAGAGAAGACAAAGACCCGCAAAAGATGTATGCCACCATCTATGAGCTGAAAGAAGACAAGAGCTACAATGTCACCTCCGTCCTGTTTAG GAAAAAGAAGTGTGACTACTGGATCAGGACTTTTGTTCCAGGTTGCCAGCCCGGCGAGTTCACGCTGGGCAACATTAAGAGTTACCCTGG ATTAACGAGTTACCTCGTCCGAGTGGTGAGCACCAACTACAACCAGCATGCTATGGTGTTCTTCAAGAAAGTTTCTCAAAACAGGGAGTA CTTCAAGATCACCCTCTACGGGAGAACCAAGGAGCTGACTTCGGAACTAAAGGAGAACTTCATCCGCTTCTCCAAATCTCTGGGCCTCCC >10182_10182_1_BRD3-LCN2_BRD3_chr9_136917427_ENST00000371834_LCN2_chr9_130912516_ENST00000373017_length(amino acids)=269AA_BP=117 MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRL ENNYYWSASECMQDFNTMFTNCYIYNKFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQP -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for BRD3-LCN2 |
![]() |
![]() |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for BRD3-LCN2 |
![]() (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
Related Diseases for BRD3-LCN2 |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | BRD3 | C0025149 | Medulloblastoma | 1 | CTD_human |
Hgene | BRD3 | C0205833 | Medullomyoblastoma | 1 | CTD_human |
Hgene | BRD3 | C0278510 | Childhood Medulloblastoma | 1 | CTD_human |
Hgene | BRD3 | C0278876 | Adult Medulloblastoma | 1 | CTD_human |
Hgene | BRD3 | C0751291 | Desmoplastic Medulloblastoma | 1 | CTD_human |
Hgene | BRD3 | C1275668 | Melanotic medulloblastoma | 1 | CTD_human |
Tgene | C0022660 | Kidney Failure, Acute | 5 | CTD_human | |
Tgene | C1565662 | Acute Kidney Insufficiency | 5 | CTD_human | |
Tgene | C2609414 | Acute kidney injury | 5 | CTD_human | |
Tgene | C0022658 | Kidney Diseases | 4 | CTD_human | |
Tgene | C0019193 | Hepatitis, Toxic | 2 | CTD_human | |
Tgene | C0023893 | Liver Cirrhosis, Experimental | 2 | CTD_human | |
Tgene | C0860207 | Drug-Induced Liver Disease | 2 | CTD_human | |
Tgene | C1262760 | Hepatitis, Drug-Induced | 2 | CTD_human | |
Tgene | C3658290 | Drug-Induced Acute Liver Injury | 2 | CTD_human | |
Tgene | C4277682 | Chemical and Drug Induced Liver Injury | 2 | CTD_human | |
Tgene | C4279912 | Chemically-Induced Liver Toxicity | 2 | CTD_human | |
Tgene | C0002875 | Cooley's anemia | 1 | CTD_human | |
Tgene | C0003873 | Rheumatoid Arthritis | 1 | CTD_human | |
Tgene | C0005283 | beta Thalassemia | 1 | CTD_human | |
Tgene | C0006663 | Calcinosis | 1 | CTD_human | |
Tgene | C0006826 | Malignant Neoplasms | 1 | CTD_human | |
Tgene | C0007570 | Celiac Disease | 1 | CTD_human | |
Tgene | C0011616 | Contact Dermatitis | 1 | CTD_human | |
Tgene | C0013221 | Drug toxicity | 1 | CTD_human | |
Tgene | C0018824 | Heart valve disease | 1 | CTD_human | |
Tgene | C0019025 | Hemoglobin F Disease | 1 | CTD_human | |
Tgene | C0019188 | Hepatitis, Animal | 1 | CTD_human | |
Tgene | C0021368 | Inflammation | 1 | CTD_human | |
Tgene | C0027627 | Neoplasm Metastasis | 1 | CTD_human | |
Tgene | C0027651 | Neoplasms | 1 | CTD_human | |
Tgene | C0035222 | Respiratory Distress Syndrome, Adult | 1 | CTD_human | |
Tgene | C0036341 | Schizophrenia | 1 | PSYGENET | |
Tgene | C0041755 | Adverse reaction to drug | 1 | CTD_human | |
Tgene | C0085578 | Thalassemia Minor | 1 | CTD_human | |
Tgene | C0086692 | Benign Neoplasm | 1 | CTD_human | |
Tgene | C0162351 | Contact hypersensitivity | 1 | CTD_human | |
Tgene | C0263628 | Tumoral calcinosis | 1 | CTD_human | |
Tgene | C0271979 | Thalassemia Intermedia | 1 | CTD_human | |
Tgene | C0403447 | Chronic Kidney Insufficiency | 1 | CTD_human | |
Tgene | C0521174 | Microcalcification | 1 | CTD_human | |
Tgene | C1561643 | Chronic Kidney Diseases | 1 | CTD_human |