|
Fusion Gene Summary | |
Fusion Gene ORF analysis | |
Fusion Genomic Features | |
Fusion Protein Features | |
Fusion Gene Sequence | |
Fusion Gene PPI analysis | |
Related Drugs | |
Related Diseases |
Fusion gene:BAZ1B-MET (FusionGDB2 ID:HG9031TG4233) |
Fusion Gene Summary for BAZ1B-MET |
Fusion gene summary |
Fusion gene information | Fusion gene name: BAZ1B-MET | Fusion gene ID: hg9031tg4233 | Hgene | Tgene | Gene symbol | BAZ1B | MET | Gene ID | 9031 | 4233 |
Gene name | bromodomain adjacent to zinc finger domain 1B | MET proto-oncogene, receptor tyrosine kinase | |
Synonyms | WBSCR10|WBSCR9|WSTF | AUTS9|DFNB97|HGFR|RCCP2|c-Met | |
Cytomap | ('BAZ1B')('MET') 7q11.23 | 7q31.2 | |
Type of gene | protein-coding | protein-coding | |
Description | tyrosine-protein kinase BAZ1BhWALp2transcription factor WSTFwilliams syndrome transcription factorwilliams-Beuren syndrome chromosomal region 10 proteinwilliams-Beuren syndrome chromosomal region 9 protein | hepatocyte growth factor receptorHGF receptorHGF/SF receptorSF receptorproto-oncogene c-Metscatter factor receptortyrosine-protein kinase Met | |
Modification date | 20200313 | 20200315 | |
UniProtAcc | . | P08581 | |
Ensembl transtripts involved in fusion gene | ENST00000339594, ENST00000404251, | ||
Fusion gene scores | * DoF score | 14 X 17 X 6=1428 | 14 X 18 X 10=2520 |
# samples | 20 | 27 | |
** MAII score | log2(20/1428*10)=-2.83592407425437 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(27/2520*10)=-3.22239242133645 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context | PubMed: BAZ1B [Title/Abstract] AND MET [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint | BAZ1B(72912827)-MET(116435709), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | BAZ1B-MET seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. BAZ1B-MET seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. BAZ1B-MET seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. BAZ1B-MET seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. BAZ1B-MET seems lost the major protein functional domain in Hgene partner, which is a epigenetic factor due to the frame-shifted ORF. BAZ1B-MET seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. BAZ1B-MET seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. BAZ1B-MET seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. BAZ1B-MET seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. BAZ1B-MET seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. BAZ1B-MET seems lost the major protein functional domain in Tgene partner, which is a kinase due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | BAZ1B | GO:0006974 | cellular response to DNA damage stimulus | 19092802 |
Hgene | BAZ1B | GO:0016572 | histone phosphorylation | 19092802 |
Tgene | MET | GO:0001886 | endothelial cell morphogenesis | 14500721 |
Tgene | MET | GO:0035024 | negative regulation of Rho protein signal transduction | 25198505 |
Tgene | MET | GO:0045944 | positive regulation of transcription by RNA polymerase II | 22521434 |
Tgene | MET | GO:0050918 | positive chemotaxis | 15218527 |
Tgene | MET | GO:0051497 | negative regulation of stress fiber assembly | 25198505 |
Tgene | MET | GO:0070495 | negative regulation of thrombin-activated receptor signaling pathway | 25198505 |
Tgene | MET | GO:0071526 | semaphorin-plexin signaling pathway | 15218527 |
Tgene | MET | GO:1905098 | negative regulation of guanyl-nucleotide exchange factor activity | 25198505 |
Fusion gene breakpoints across BAZ1B (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across MET (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene information * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-BR-8080-01A | BAZ1B | chr7 | 72912827 | - | MET | chr7 | 116435709 | + |
Top |
Fusion Gene ORF analysis for BAZ1B-MET |
Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
ORF | Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
5CDS-intron | ENST00000339594 | ENST00000436117 | BAZ1B | chr7 | 72912827 | - | MET | chr7 | 116435709 | + |
5CDS-intron | ENST00000339594 | ENST00000495962 | BAZ1B | chr7 | 72912827 | - | MET | chr7 | 116435709 | + |
5CDS-intron | ENST00000339594 | ENST00000539704 | BAZ1B | chr7 | 72912827 | - | MET | chr7 | 116435709 | + |
5CDS-intron | ENST00000404251 | ENST00000436117 | BAZ1B | chr7 | 72912827 | - | MET | chr7 | 116435709 | + |
5CDS-intron | ENST00000404251 | ENST00000495962 | BAZ1B | chr7 | 72912827 | - | MET | chr7 | 116435709 | + |
5CDS-intron | ENST00000404251 | ENST00000539704 | BAZ1B | chr7 | 72912827 | - | MET | chr7 | 116435709 | + |
Frame-shift | ENST00000404251 | ENST00000318493 | BAZ1B | chr7 | 72912827 | - | MET | chr7 | 116435709 | + |
Frame-shift | ENST00000404251 | ENST00000397752 | BAZ1B | chr7 | 72912827 | - | MET | chr7 | 116435709 | + |
In-frame | ENST00000339594 | ENST00000318493 | BAZ1B | chr7 | 72912827 | - | MET | chr7 | 116435709 | + |
In-frame | ENST00000339594 | ENST00000397752 | BAZ1B | chr7 | 72912827 | - | MET | chr7 | 116435709 | + |
ORFfinder result based on the fusion transcript sequence of in-frame fusion genes. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000339594 | BAZ1B | chr7 | 72912827 | - | ENST00000397752 | MET | chr7 | 116435709 | + | 3547 | 910 | 168 | 968 | 266 |
ENST00000339594 | BAZ1B | chr7 | 72912827 | - | ENST00000318493 | MET | chr7 | 116435709 | + | 1503 | 910 | 168 | 968 | 266 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000339594 | ENST00000397752 | BAZ1B | chr7 | 72912827 | - | MET | chr7 | 116435709 | + | 0.000550512 | 0.99944943 |
ENST00000339594 | ENST00000318493 | BAZ1B | chr7 | 72912827 | - | MET | chr7 | 116435709 | + | 0.001591122 | 0.99840885 |
Top |
Fusion Genomic Features for BAZ1B-MET |
FusionAI prediction of the potential fusion gene breakpoint based on the pre-mature RNA sequence context (+/- 5kb of individual partner genes, total 20kb length sequence). FusionAI is a fusion gene breakpoint classifier based on convolutional neural network by comparing the fusion positive and negative sequence context of ~ 20K fusion gene data. From here, we can have the relative potentency of the 20K genomic sequence how individual sequnce will be likely used as the gene fusion breakpoints. |
Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | 1-p | p (fusion gene breakpoint) |
BAZ1B | chr7 | 72912826 | - | MET | chr7 | 116435708 | + | 5.04E-09 | 1 |
BAZ1B | chr7 | 72912826 | - | MET | chr7 | 116435708 | + | 5.04E-09 | 1 |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions. We integrated a total of 44 different types of human genomic feature loci information across five big categories including virus integration sites, repeats, structural variants, chromatin states, and gene expression regulation. More details are in help page. |
Distribution of 44 human genomic features loci across 20kb length fusion breakpoint regions that are ovelapped with the top 1% feature importance score regions. More details are in help page. |
Top |
Fusion Protein Features for BAZ1B-MET |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr7:72912827/chr7:116435709) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
. | MET |
FUNCTION: Transcriptional activator which is required for calcium-dependent dendritic growth and branching in cortical neurons. Recruits CREB-binding protein (CREBBP) to nuclear bodies. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP (By similarity). {ECO:0000250}. | FUNCTION: Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to hepatocyte growth factor/HGF ligand. Regulates many physiological processes including proliferation, scattering, morphogenesis and survival. Ligand binding at the cell surface induces autophosphorylation of MET on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with the PI3-kinase subunit PIK3R1, PLCG1, SRC, GRB2, STAT3 or the adapter GAB1. Recruitment of these downstream effectors by MET leads to the activation of several signaling cascades including the RAS-ERK, PI3 kinase-AKT, or PLCgamma-PKC. The RAS-ERK activation is associated with the morphogenetic effects while PI3K/AKT coordinates prosurvival effects. During embryonic development, MET signaling plays a role in gastrulation, development and migration of muscles and neuronal precursors, angiogenesis and kidney formation. In adults, participates in wound healing as well as organ regeneration and tissue remodeling. Promotes also differentiation and proliferation of hematopoietic cells. May regulate cortical bone osteogenesis (By similarity). {ECO:0000250|UniProtKB:P16056}.; FUNCTION: (Microbial infection) Acts as a receptor for Listeria monocytogenes internalin InlB, mediating entry of the pathogen into cells. {ECO:0000269|PubMed:11081636, ECO:0000305|PubMed:17662939, ECO:0000305|PubMed:19900460}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- In-frame and retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000339594 | - | 4 | 20 | 20_126 | 190 | 1852.6666666666667 | Domain | WAC |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000404251 | - | 4 | 19 | 20_126 | 190 | 1484.0 | Domain | WAC |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000436117 | 0 | 9 | 1078_1345 | 0 | 765.0 | Domain | Protein kinase | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000436117 | 0 | 9 | 27_515 | 0 | 765.0 | Domain | Sema | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000436117 | 0 | 9 | 563_655 | 0 | 765.0 | Domain | Note=IPT/TIG 1 | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000436117 | 0 | 9 | 657_739 | 0 | 765.0 | Domain | Note=IPT/TIG 2 | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000436117 | 0 | 9 | 742_836 | 0 | 765.0 | Domain | Note=IPT/TIG 3 | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000436117 | 0 | 9 | 1084_1092 | 0 | 765.0 | Nucleotide binding | ATP | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000436117 | 0 | 9 | 25_932 | 0 | 765.0 | Topological domain | Extracellular | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000436117 | 0 | 9 | 956_1390 | 0 | 765.0 | Topological domain | Cytoplasmic | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000436117 | 0 | 9 | 933_955 | 0 | 765.0 | Transmembrane | Helical |
- In-frame and not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000339594 | - | 4 | 20 | 1245_1283 | 190 | 1852.6666666666667 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000339594 | - | 4 | 20 | 533_586 | 190 | 1852.6666666666667 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000339594 | - | 4 | 20 | 768_814 | 190 | 1852.6666666666667 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000339594 | - | 4 | 20 | 850_893 | 190 | 1852.6666666666667 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000404251 | - | 4 | 19 | 1245_1283 | 190 | 1484.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000404251 | - | 4 | 19 | 533_586 | 190 | 1484.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000404251 | - | 4 | 19 | 768_814 | 190 | 1484.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000404251 | - | 4 | 19 | 850_893 | 190 | 1484.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000339594 | - | 4 | 20 | 1261_1273 | 190 | 1852.6666666666667 | Compositional bias | Note=Poly-Glu |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000339594 | - | 4 | 20 | 306_578 | 190 | 1852.6666666666667 | Compositional bias | Note=Lys-rich |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000404251 | - | 4 | 19 | 1261_1273 | 190 | 1484.0 | Compositional bias | Note=Poly-Glu |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000404251 | - | 4 | 19 | 306_578 | 190 | 1484.0 | Compositional bias | Note=Lys-rich |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000339594 | - | 4 | 20 | 1356_1426 | 190 | 1852.6666666666667 | Domain | Bromo |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000339594 | - | 4 | 20 | 604_668 | 190 | 1852.6666666666667 | Domain | DDT |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000404251 | - | 4 | 19 | 1356_1426 | 190 | 1484.0 | Domain | Bromo |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000404251 | - | 4 | 19 | 604_668 | 190 | 1484.0 | Domain | DDT |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000339594 | - | 4 | 20 | 207_213 | 190 | 1852.6666666666667 | Motif | Note=C motif |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000404251 | - | 4 | 19 | 207_213 | 190 | 1484.0 | Motif | Note=C motif |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000339594 | - | 4 | 20 | 1184_1234 | 190 | 1852.6666666666667 | Zinc finger | PHD-type |
Hgene | BAZ1B | chr7:72912827 | chr7:116435709 | ENST00000404251 | - | 4 | 19 | 1184_1234 | 190 | 1484.0 | Zinc finger | PHD-type |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000318493 | 18 | 21 | 1078_1345 | 1284 | 1409.0 | Domain | Protein kinase | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000318493 | 18 | 21 | 27_515 | 1284 | 1409.0 | Domain | Sema | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000318493 | 18 | 21 | 563_655 | 1284 | 1409.0 | Domain | Note=IPT/TIG 1 | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000318493 | 18 | 21 | 657_739 | 1284 | 1409.0 | Domain | Note=IPT/TIG 2 | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000318493 | 18 | 21 | 742_836 | 1284 | 1409.0 | Domain | Note=IPT/TIG 3 | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000397752 | 18 | 21 | 1078_1345 | 1266 | 1391.0 | Domain | Protein kinase | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000397752 | 18 | 21 | 27_515 | 1266 | 1391.0 | Domain | Sema | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000397752 | 18 | 21 | 563_655 | 1266 | 1391.0 | Domain | Note=IPT/TIG 1 | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000397752 | 18 | 21 | 657_739 | 1266 | 1391.0 | Domain | Note=IPT/TIG 2 | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000397752 | 18 | 21 | 742_836 | 1266 | 1391.0 | Domain | Note=IPT/TIG 3 | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000318493 | 18 | 21 | 1084_1092 | 1284 | 1409.0 | Nucleotide binding | ATP | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000397752 | 18 | 21 | 1084_1092 | 1266 | 1391.0 | Nucleotide binding | ATP | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000318493 | 18 | 21 | 25_932 | 1284 | 1409.0 | Topological domain | Extracellular | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000318493 | 18 | 21 | 956_1390 | 1284 | 1409.0 | Topological domain | Cytoplasmic | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000397752 | 18 | 21 | 25_932 | 1266 | 1391.0 | Topological domain | Extracellular | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000397752 | 18 | 21 | 956_1390 | 1266 | 1391.0 | Topological domain | Cytoplasmic | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000318493 | 18 | 21 | 933_955 | 1284 | 1409.0 | Transmembrane | Helical | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000397752 | 18 | 21 | 933_955 | 1266 | 1391.0 | Transmembrane | Helical |
Top |
Fusion Gene Sequence for BAZ1B-MET |
For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences. To have fusion amino acid sequence, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>9028_9028_1_BAZ1B-MET_BAZ1B_chr7_72912827_ENST00000339594_MET_chr7_116435709_ENST00000318493_length(transcript)=1503nt_BP=910nt CGGGGGAGGAGGGGAATCTCCCGCCATTTTTCAATAATTTCCTCCGGTGCTGCTGAGGAGGAGTCGTGACTGCCGGCCGCCGGGACCCGA AGCGGAGGTCGGCGGGGGGCTGCTGGGAGGCGCGGCGGTGTGCGCGGGAGCTCTGCGCCGTGGCGTTCCGCTCCATGACTGTCGCGCGGC CGCGCCGGCGGTGAGGGAGCCGGAGTTCGCGCCGCCCTCTCACCCCTCCCTTCCCCCACCCCACCCCCGGGCGCCTGGCGCTCGCTCCGG GCCGCGGGGCCTAGTGCTGCGCCGCGGGGCCGGCCCCAGCAGCCGCCAGTCCCCACCGCCGCCGCCGCGATGGCGCCGCTCCTGGGCCGC AAGCCCTTCCCGCTGGTGAAGCCGTTGCCCGGAGAGGAGCCGCTCTTCACCATCCCGCACACTCAGGAGGCCTTCCGCACCCGGGAAGAG TATGAAGCCCGCTTGGAAAGGTACAGTGAGCGCATTTGGACGTGCAAGAGTACTGGAAGCAGTCAGCTAACACACAAGGAAGCCTGGGAG GAAGAACAGGAAGTTGCTGAGCTTTTGAAGGAGGAGTTTCCTGCCTGGTATGAGAAGCTTGTTCTGGAAATGGTTCACCATAACACAGCC TCCTTAGAGAAGTTAGTAGATACTGCTTGGTTGGAGATCATGACCAAATATGCTGTGGGAGAAGAGTGTGACTTCGAGGTTGGGAAGGAG AAAATGCTCAAGGTGAAGATTGTGAAGATTCATCCTTTGGAGAAAGTGGATGAAGAGGCCACTGAGAAGAAATCTGATGGTGCCTGTGAT TCTCCATCAAGTGACAAAGAGAACTCCAGTCAGATTGCTCAGGACCATCAGAAGAAGGAGACAGTTGTGAAAGAGGATGAAGGAAGGAGA GAGAGTATTATGGTCCTTTGGCGTGCTCCTCTGGGAGCTGATGACAAGAGGAGCCCCACCTTATCCTGACGTAAACACCTTTGATATAAC TGTTTACTTGTTGCAAGGGAGAAGACTCCTACAACCCGAATACTGCCCAGACCCCTTATATGAAGTAATGCTAAAATGCTGGCACCCTAA AGCCGAAATGCGCCCATCCTTTTCTGAACTGGTGTCCCGGATATCAGCGATCTTCTCTACTTTCATTGGGGAGCACTATGTCCATGTGAA CGCTACTTATGTGAACGTAAAATGTGTCGCTCCGTATCCTTCTCTGTTGTCATCAGAAGATAACGCTGATGATGAGGTGGACACACGACC AGCCTCCTTCTGGGAGACATCATAGTGCTAGTACTATGTCAAAGCAACAGTCCACACTTTGTCCAATGGTTTTTTCACTGCCTGACCTTT AAAAGGCCATCGATATTCTTTGCTCTTGCCAAAATTGCACTATTATAGGACTTGTATTGTTATTTAAATTACTGGATTCTAAGGAATTTC >9028_9028_1_BAZ1B-MET_BAZ1B_chr7_72912827_ENST00000339594_MET_chr7_116435709_ENST00000318493_length(amino acids)=266AA_BP=248 MSRGRAGGEGAGVRAALSPLPSPTPPPGAWRSLRAAGPSAAPRGRPQQPPVPTAAAAMAPLLGRKPFPLVKPLPGEEPLFTIPHTQEAFR TREEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQEVAELLKEEFPAWYEKLVLEMVHHNTASLEKLVDTAWLEIMTKYAVGEECDFE -------------------------------------------------------------- >9028_9028_2_BAZ1B-MET_BAZ1B_chr7_72912827_ENST00000339594_MET_chr7_116435709_ENST00000397752_length(transcript)=3547nt_BP=910nt CGGGGGAGGAGGGGAATCTCCCGCCATTTTTCAATAATTTCCTCCGGTGCTGCTGAGGAGGAGTCGTGACTGCCGGCCGCCGGGACCCGA AGCGGAGGTCGGCGGGGGGCTGCTGGGAGGCGCGGCGGTGTGCGCGGGAGCTCTGCGCCGTGGCGTTCCGCTCCATGACTGTCGCGCGGC CGCGCCGGCGGTGAGGGAGCCGGAGTTCGCGCCGCCCTCTCACCCCTCCCTTCCCCCACCCCACCCCCGGGCGCCTGGCGCTCGCTCCGG GCCGCGGGGCCTAGTGCTGCGCCGCGGGGCCGGCCCCAGCAGCCGCCAGTCCCCACCGCCGCCGCCGCGATGGCGCCGCTCCTGGGCCGC AAGCCCTTCCCGCTGGTGAAGCCGTTGCCCGGAGAGGAGCCGCTCTTCACCATCCCGCACACTCAGGAGGCCTTCCGCACCCGGGAAGAG TATGAAGCCCGCTTGGAAAGGTACAGTGAGCGCATTTGGACGTGCAAGAGTACTGGAAGCAGTCAGCTAACACACAAGGAAGCCTGGGAG GAAGAACAGGAAGTTGCTGAGCTTTTGAAGGAGGAGTTTCCTGCCTGGTATGAGAAGCTTGTTCTGGAAATGGTTCACCATAACACAGCC TCCTTAGAGAAGTTAGTAGATACTGCTTGGTTGGAGATCATGACCAAATATGCTGTGGGAGAAGAGTGTGACTTCGAGGTTGGGAAGGAG AAAATGCTCAAGGTGAAGATTGTGAAGATTCATCCTTTGGAGAAAGTGGATGAAGAGGCCACTGAGAAGAAATCTGATGGTGCCTGTGAT TCTCCATCAAGTGACAAAGAGAACTCCAGTCAGATTGCTCAGGACCATCAGAAGAAGGAGACAGTTGTGAAAGAGGATGAAGGAAGGAGA GAGAGTATTATGGTCCTTTGGCGTGCTCCTCTGGGAGCTGATGACAAGAGGAGCCCCACCTTATCCTGACGTAAACACCTTTGATATAAC TGTTTACTTGTTGCAAGGGAGAAGACTCCTACAACCCGAATACTGCCCAGACCCCTTATATGAAGTAATGCTAAAATGCTGGCACCCTAA AGCCGAAATGCGCCCATCCTTTTCTGAACTGGTGTCCCGGATATCAGCGATCTTCTCTACTTTCATTGGGGAGCACTATGTCCATGTGAA CGCTACTTATGTGAACGTAAAATGTGTCGCTCCGTATCCTTCTCTGTTGTCATCAGAAGATAACGCTGATGATGAGGTGGACACACGACC AGCCTCCTTCTGGGAGACATCATAGTGCTAGTACTATGTCAAAGCAACAGTCCACACTTTGTCCAATGGTTTTTTCACTGCCTGACCTTT AAAAGGCCATCGATATTCTTTGCTCTTGCCAAAATTGCACTATTATAGGACTTGTATTGTTATTTAAATTACTGGATTCTAAGGAATTTC TTATCTGACAGAGCATCAGAACCAGAGGCTTGGTCCCACAGGCCACGGACCAATGGCCTGCAGCCGTGACAACACTCCTGTCATATTGGA GTCCAAAACTTGAATTCTGGGTTGAATTTTTTAAAAATCAGGTACCACTTGATTTCATATGGGAAATTGAAGCAGGAAATATTGAGGGCT TCTTGATCACAGAAAACTCAGAAGAGATAGTAATGCTCAGGACAGGAGCGGCAGCCCCAGAACAGGCCACTCATTTAGAATTCTAGTGTT TCAAAACACTTTTGTGTGTTGTATGGTCAATAACATTTTTCATTACTGATGGTGTCATTCACCCATTAGGTAAACATTCCCTTTTAAATG TTTGTTTGTTTTTTGAGACAGGATCTCACTCTGTTGCCAGGGCTGTAGTGCAGTGGTGTGATCATAGCTCACTGCAACCTCCACCTCCCA GGCTCAAGCCTCCCGAATAGCTGGGACTACAGGCGCACACCACCATCCCCGGCTAATTTTTGTATTTTTTGTAGAGACGGGGTTTTGCCA TGTTGCCAAGGCTGGTTTCAAACTCCTGGACTCAAGAAATCCACCCACCTCAGCCTCCCAAAGTGCTAGGATTACAGGCATGAGCCACTG CGCCCAGCCCTTATAAATTTTTGTATAGACATTCCTTTGGTTGGAAGAATATTTATAGGCAATACAGTCAAAGTTTCAAAATAGCATCAC ACAAAACATGTTTATAAATGAACAGGATGTAATGTACATAGATGACATTAAGAAAATTTGTATGAAATAATTTAGTCATCATGAAATATT TAGTTGTCATATAAAAACCCACTGTTTGAGAATGATGCTACTCTGATCTAATGAATGTGAACATGTAGATGTTTTGTGTGTATTTTTTTA AATGAAAACTCAAAATAAGACAAGTAATTTGTTGATAAATATTTTTAAAGATAACTCAGCATGTTTGTAAAGCAGGATACATTTTACTAA AAGGTTCATTGGTTCCAATCACAGCTCATAGGTAGAGCAAAGAAAGGGTGGATGGATTGAAAAGATTAGCCTCTGTCTCGGTGGCAGGTT CCCACCTCGCAAGCAATTGGAAACAAAACTTTTGGGGAGTTTTATTTTGCATTAGGGTGTGTTTTATGTTAAGCAAAACATACTTTAGAA ACAAATGAAAAAGGCAATTGAAAATCCCAGCTATTTCACCTAGATGGAATAGCCACCCTGAGCAGAACTTTGTGATGCTTCATTCTGTGG AATTTTGTGCTTGCTACTGTATAGTGCATGTGGTGTAGGTTACTCTAACTGGTTTTGTCGACGTAAACATTTAAAGTGTTATATTTTTTA TAAAAATGTTTATTTTTAATGATATGAGAAAAATTTTGTTAGGCCACAAAAACACTGCACTGTGAACATTTTAGAAAAGGTATGTCAGAC TGGGATTAATGACAGCATGATTTTCAATGACTGTAAATTGCGATAAGGAAATGTACTGATTGCCAATACACCCCACCCTCATTACATCAT CAGGACTTGAAGCCAAGGGTTAACCCAGCAAGCTACAAAGAGGGTGTGTCACACTGAAACTCAATAGTTGAGTTTGGCTGTTGTTGCAGG AAAATGATTATAACTAAAAGCTCTCTGATAGTGCAGAGACTTACCAGAAGACACAAGGAATTGTACTGAAGAGCTATTACAATCCAAATA TTGCCGTTTCATAAATGTAATAAGTAATACTAATTCACAGAGTATTGTAAATGGTGGATGACAAAAGAAAATCTGCTCTGTGGAAAGAAA GAACTGTCTCTACCAGGGTCAAGAGCATGAACGCATCAATAGAAAGAACTCGGGGAAACATCCCATCAACAGGACTACACACTTGTATAT ACATTCTTGAGAACACTGCAATGTGAAAATCACGTTTGCTATTTATAAACTTGTCCTTAGATTAATGTGTCTGGACAGATTGTGGGAGTA AGTGATTCTTCTAAGAATTAGATACTTGTCACTGCCTATACCTGCAGCTGAACTGAATGGTACTTCGTATGTTAATAGTTGTTCTGATAA >9028_9028_2_BAZ1B-MET_BAZ1B_chr7_72912827_ENST00000339594_MET_chr7_116435709_ENST00000397752_length(amino acids)=266AA_BP=248 MSRGRAGGEGAGVRAALSPLPSPTPPPGAWRSLRAAGPSAAPRGRPQQPPVPTAAAAMAPLLGRKPFPLVKPLPGEEPLFTIPHTQEAFR TREEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQEVAELLKEEFPAWYEKLVLEMVHHNTASLEKLVDTAWLEIMTKYAVGEECDFE -------------------------------------------------------------- |
Top |
Fusion Gene PPI Analysis for BAZ1B-MET |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160) |
Hgene | Hgene's interactors | Tgene | Tgene's interactors |
- Retained PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000318493 | 18 | 21 | 1320_1359 | 1284.0 | 1409.0 | MUC20 | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000397752 | 18 | 21 | 1320_1359 | 1266.0 | 1391.0 | MUC20 | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000436117 | 0 | 9 | 1320_1359 | 0.0 | 765.0 | MUC20 | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000436117 | 0 | 9 | 1212_1390 | 0.0 | 765.0 | RANBP9 |
- Lost PPIs in in-frame fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000318493 | 18 | 21 | 1212_1390 | 1284.0 | 1409.0 | RANBP9 | |
Tgene | MET | chr7:72912827 | chr7:116435709 | ENST00000397752 | 18 | 21 | 1212_1390 | 1266.0 | 1391.0 | RANBP9 |
- Retained PPIs, but lost function due to frame-shift fusion. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs for BAZ1B-MET |
Drugs targeting genes involved in this fusion gene. (DrugBank Version 5.1.8 2021-05-08) |
Partner | Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Tgene | MET | P08581 | DB08865 | Crizotinib | Inhibitor | Small molecule | Approved |
Tgene | MET | P08581 | DB08875 | Cabozantinib | Antagonist | Small molecule | Approved|Investigational |
Tgene | MET | P08581 | DB11791 | Capmatinib | Inhibitor | Small molecule | Approved|Investigational |
Tgene | MET | P08581 | DB12010 | Fostamatinib | Inhibitor | Small molecule | Approved|Investigational |
Tgene | MET | P08581 | DB12267 | Brigatinib | Inhibitor | Small molecule | Approved|Investigational |
Top |
Related Diseases for BAZ1B-MET |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | BAZ1B | C0175702 | Williams Syndrome | 1 | CTD_human |
Tgene | C1306837 | Papillary Renal Cell Carcinoma | 9 | CGI;CLINGEN;CTD_human;ORPHANET | |
Tgene | C1336078 | Papillary renal cell carcinoma, sporadic | 7 | CLINGEN | |
Tgene | C1336839 | Type 1 Papillary Renal Cell Carcinoma | 5 | UNIPROT | |
Tgene | C0007131 | Non-Small Cell Lung Carcinoma | 4 | CGI;CTD_human | |
Tgene | C1836723 | Tibia, Bowing of, with Pseudarthrosis and Pectus Excavatum | 4 | ORPHANET | |
Tgene | C4085248 | OSTEOFIBROUS DYSPLASIA, SUSCEPTIBILITY TO | 4 | ORPHANET | |
Tgene | C0001418 | Adenocarcinoma | 2 | CTD_human | |
Tgene | C0004352 | Autistic Disorder | 2 | CTD_human | |
Tgene | C0024623 | Malignant neoplasm of stomach | 2 | CGI;CTD_human;UNIPROT | |
Tgene | C0027627 | Neoplasm Metastasis | 2 | CTD_human | |
Tgene | C0038356 | Stomach Neoplasms | 2 | CGI;CTD_human | |
Tgene | C0205641 | Adenocarcinoma, Basal Cell | 2 | CTD_human | |
Tgene | C0205642 | Adenocarcinoma, Oxyphilic | 2 | CTD_human | |
Tgene | C0205643 | Carcinoma, Cribriform | 2 | CTD_human | |
Tgene | C0205644 | Carcinoma, Granular Cell | 2 | CTD_human | |
Tgene | C0205645 | Adenocarcinoma, Tubular | 2 | CTD_human | |
Tgene | C1708349 | Hereditary Diffuse Gastric Cancer | 2 | CTD_human | |
Tgene | C0004114 | Astrocytoma | 1 | CTD_human | |
Tgene | C0007097 | Carcinoma | 1 | CTD_human | |
Tgene | C0007134 | Renal Cell Carcinoma | 1 | CTD_human | |
Tgene | C0007137 | Squamous cell carcinoma | 1 | CTD_human | |
Tgene | C0009241 | Cognition Disorders | 1 | CTD_human | |
Tgene | C0014859 | Esophageal Neoplasms | 1 | CTD_human | |
Tgene | C0017636 | Glioblastoma | 1 | CTD_human | |
Tgene | C0019189 | Hepatitis, Chronic | 1 | CTD_human | |
Tgene | C0019207 | Hepatoma, Morris | 1 | CTD_human | |
Tgene | C0019208 | Hepatoma, Novikoff | 1 | CTD_human | |
Tgene | C0023467 | Leukemia, Myelocytic, Acute | 1 | CTD_human | |
Tgene | C0023904 | Liver Neoplasms, Experimental | 1 | CTD_human | |
Tgene | C0024121 | Lung Neoplasms | 1 | CTD_human | |
Tgene | C0024232 | Lymphatic Metastasis | 1 | CTD_human | |
Tgene | C0025202 | melanoma | 1 | CTD_human | |
Tgene | C0026998 | Acute Myeloid Leukemia, M1 | 1 | CTD_human | |
Tgene | C0027626 | Neoplasm Invasiveness | 1 | CTD_human | |
Tgene | C0027819 | Neuroblastoma | 1 | CTD_human | |
Tgene | C0029463 | Osteosarcoma | 1 | CTD_human | |
Tgene | C0033578 | Prostatic Neoplasms | 1 | CTD_human | |
Tgene | C0036341 | Schizophrenia | 1 | CTD_human | |
Tgene | C0037199 | Sinusitis | 1 | CTD_human | |
Tgene | C0086404 | Experimental Hepatoma | 1 | CTD_human | |
Tgene | C0149519 | Chronic Persistent Hepatitis | 1 | CTD_human | |
Tgene | C0205696 | Anaplastic carcinoma | 1 | CTD_human | |
Tgene | C0205697 | Carcinoma, Spindle-Cell | 1 | CTD_human | |
Tgene | C0205698 | Undifferentiated carcinoma | 1 | CTD_human | |
Tgene | C0205699 | Carcinomatosis | 1 | CTD_human | |
Tgene | C0205768 | Subependymal Giant Cell Astrocytoma | 1 | CTD_human | |
Tgene | C0242379 | Malignant neoplasm of lung | 1 | CTD_human | |
Tgene | C0279606 | Childhood Hepatocellular Carcinoma | 1 | ORPHANET | |
Tgene | C0279702 | Conventional (Clear Cell) Renal Cell Carcinoma | 1 | CGI;CTD_human | |
Tgene | C0280783 | Juvenile Pilocytic Astrocytoma | 1 | CTD_human | |
Tgene | C0280785 | Diffuse Astrocytoma | 1 | CTD_human | |
Tgene | C0334579 | Anaplastic astrocytoma | 1 | CTD_human | |
Tgene | C0334580 | Protoplasmic astrocytoma | 1 | CTD_human | |
Tgene | C0334581 | Gemistocytic astrocytoma | 1 | CTD_human | |
Tgene | C0334582 | Fibrillary Astrocytoma | 1 | CTD_human | |
Tgene | C0334583 | Pilocytic Astrocytoma | 1 | CTD_human | |
Tgene | C0334588 | Giant Cell Glioblastoma | 1 | CTD_human | |
Tgene | C0338070 | Childhood Cerebral Astrocytoma | 1 | CTD_human | |
Tgene | C0345967 | Malignant mesothelioma | 1 | CTD_human | |
Tgene | C0376358 | Malignant neoplasm of prostate | 1 | CTD_human | |
Tgene | C0520463 | Chronic active hepatitis | 1 | CTD_human | |
Tgene | C0524611 | Cryptogenic Chronic Hepatitis | 1 | CTD_human | |
Tgene | C0546837 | Malignant neoplasm of esophagus | 1 | CTD_human | |
Tgene | C0547065 | Mixed oligoastrocytoma | 1 | CTD_human | |
Tgene | C0750935 | Cerebral Astrocytoma | 1 | CTD_human | |
Tgene | C0750936 | Intracranial Astrocytoma | 1 | CTD_human | |
Tgene | C0919267 | ovarian neoplasm | 1 | CTD_human | |
Tgene | C1140680 | Malignant neoplasm of ovary | 1 | CTD_human | |
Tgene | C1266042 | Chromophobe Renal Cell Carcinoma | 1 | CTD_human | |
Tgene | C1266043 | Sarcomatoid Renal Cell Carcinoma | 1 | CTD_human | |
Tgene | C1266044 | Collecting Duct Carcinoma of the Kidney | 1 | CTD_human | |
Tgene | C1621958 | Glioblastoma Multiforme | 1 | CTD_human | |
Tgene | C1704230 | Grade I Astrocytoma | 1 | CTD_human | |
Tgene | C1708353 | Hereditary Paraganglioma-Pheochromocytoma Syndrome | 1 | CLINGEN | |
Tgene | C1876165 | Copper-Overload Cirrhosis | 1 | CTD_human | |
Tgene | C1879321 | Acute Myeloid Leukemia (AML-M2) | 1 | CTD_human | |
Tgene | C2239176 | Liver carcinoma | 1 | CGI;CTD_human;UNIPROT | |
Tgene | C3711374 | Nonsyndromic Deafness | 1 | CLINGEN | |
Tgene | C4084709 | DEAFNESS, AUTOSOMAL RECESSIVE 97 | 1 | CTD_human;UNIPROT |