| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:ZFP36-OAZ1 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: ZFP36-OAZ1 | FusionPDB ID: 101060 | FusionGDB2.0 ID: 101060 | Hgene | Tgene | Gene symbol | ZFP36 | OAZ1 | Gene ID | 7538 | 4946 |
| Gene name | ZFP36 ring finger protein | ornithine decarboxylase antizyme 1 | |
| Synonyms | G0S24|GOS24|NUP475|RNF162A|TIS11|TTP|zfp-36 | AZ1|AZI|OAZ | |
| Cytomap | 19q13.2 | 19p13.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | mRNA decay activator protein ZFP36G0/G1 switch regulatory protein 24growth factor-inducible nuclear protein NUP475tristetraprolintristetraprolinezinc finger protein 36 homologzinc finger protein 36, C3H type, homologzinc finger protein, C3H type, 3 | ornithine decarboxylase antizyme 1ODC-Azantizyme 1 | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q07352 | . | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000248673, ENST00000594045, ENST00000597629, | ENST00000322297, ENST00000582888, ENST00000583542, ENST00000588673, ENST00000602676, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 10 X 6 X 7=420 | 14 X 9 X 8=1008 |
| # samples | 10 | 15 | |
| ** MAII score | log2(10/420*10)=-2.0703893278914 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(15/1008*10)=-2.74846123300404 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: ZFP36 [Title/Abstract] AND OAZ1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ZFP36(39897568)-OAZ1(2271384), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | ZFP36-OAZ1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ZFP36-OAZ1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ZFP36-OAZ1 seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. ZFP36-OAZ1 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. ZFP36-OAZ1 seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. ZFP36-OAZ1 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | ZFP36 | GO:0000288 | nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay | 23644599 |
| Hgene | ZFP36 | GO:0006402 | mRNA catabolic process | 10330172|10751406|11782475|20221403 |
| Hgene | ZFP36 | GO:0009611 | response to wounding | 27182009 |
| Hgene | ZFP36 | GO:0031086 | nuclear-transcribed mRNA catabolic process, deadenylation-independent decay | 11279239 |
| Hgene | ZFP36 | GO:0032680 | regulation of tumor necrosis factor production | 15014438 |
| Hgene | ZFP36 | GO:0042594 | response to starvation | 15014438 |
| Hgene | ZFP36 | GO:0043488 | regulation of mRNA stability | 9703499|11719186|15687258|20702587 |
| Hgene | ZFP36 | GO:0044344 | cellular response to fibroblast growth factor stimulus | 20166898 |
| Hgene | ZFP36 | GO:0045647 | negative regulation of erythrocyte differentiation | 20702587 |
| Hgene | ZFP36 | GO:0060213 | positive regulation of nuclear-transcribed mRNA poly(A) tail shortening | 10330172 |
| Hgene | ZFP36 | GO:0061158 | 3'-UTR-mediated mRNA destabilization | 9703499|11719186|15687258|20221403|27193233 |
| Hgene | ZFP36 | GO:0070935 | 3'-UTR-mediated mRNA stabilization | 15014438 |
| Hgene | ZFP36 | GO:0071222 | cellular response to lipopolysaccharide | 14766228 |
| Hgene | ZFP36 | GO:0071356 | cellular response to tumor necrosis factor | 20166898 |
| Hgene | ZFP36 | GO:0071364 | cellular response to epidermal growth factor stimulus | 20166898 |
| Hgene | ZFP36 | GO:0071385 | cellular response to glucocorticoid stimulus | 20166898 |
| Hgene | ZFP36 | GO:0097011 | cellular response to granulocyte macrophage colony-stimulating factor stimulus | 20166898 |
| Hgene | ZFP36 | GO:1900153 | positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay | 12748283 |
| Hgene | ZFP36 | GO:1901835 | positive regulation of deadenylation-independent decapping of nuclear-transcribed mRNA | 16364915 |
| Tgene | OAZ1 | GO:0045732 | positive regulation of protein catabolic process | 17900240 |
| Fusion gene breakpoints across ZFP36 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across OAZ1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | HNSC | TCGA-CR-5250-01A | ZFP36 | chr19 | 39897568 | + | OAZ1 | chr19 | 2271384 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000594045 | ZFP36 | chr19 | 39897568 | + | ENST00000588673 | OAZ1 | chr19 | 2271384 | + | 789 | 181 | 258 | 722 | 154 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000594045 | ENST00000588673 | ZFP36 | chr19 | 39897568 | + | OAZ1 | chr19 | 2271384 | + | 0.918274 | 0.081726 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >101060_101060_1_ZFP36-OAZ1_ZFP36_chr19_39897568_ENST00000594045_OAZ1_chr19_2271384_ENST00000588673_length(amino acids)=154AA_BP= MKIPGGRGNSQRDHNLSANLFYSDDRLNVTEELTSNDKTRILNVQSRLTDAKRINWRTVLSGGSLYIEIPGGALPEGSKDSFAVLLEFAE -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:39897568/chr19:2271384) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| ZFP36 | . |
| FUNCTION: Zinc-finger RNA-binding protein that destabilizes several cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis (PubMed:12198173, PubMed:15538381, PubMed:15467755, PubMed:17030608, PubMed:19179481, PubMed:20702587, PubMed:24700863, PubMed:25106868, PubMed:25014217, PubMed:26542173). Acts as a 3'-untranslated region (UTR) ARE mRNA-binding adapter protein to communicate signaling events to the mRNA decay machinery (PubMed:15687258). Functions by recruiting the CCR4-NOT deadenylase complex and components of the cytoplasmic RNA decay machinery to the bound ARE-containing mRNAs, and hence promotes ARE-mediated mRNA deadenylation and decay processes (PubMed:15687258, PubMed:18326031, PubMed:25106868). Induces also the degradation of ARE-containing mRNAs even in absence of poly(A) tail (By similarity). Binds to 3'-UTR ARE of numerous mRNAs (PubMed:12198173, PubMed:15538381, PubMed:15467755, PubMed:17030608, PubMed:19179481, PubMed:20702587, PubMed:24700863, PubMed:25106868, PubMed:25014217, PubMed:26542173). Positively regulates early adipogenesis by promoting ARE-mediated mRNA decay of immediate early genes (IEGs) (By similarity). Promotes ARE-mediated mRNA decay of mineralocorticoid receptor NR3C2 mRNA in response to hypertonic stress (PubMed:24700863). Negatively regulates hematopoietic/erythroid cell differentiation by promoting ARE-mediated mRNA decay of the transcription factor STAT5B mRNA (PubMed:20702587). Positively regulates monocyte/macrophage cell differentiation by promoting ARE-mediated mRNA decay of the cyclin-dependent kinase CDK6 mRNA (PubMed:26542173). Promotes degradation of ARE-containing pluripotency-associated mRNAs in embryonic stem cells (ESCs), such as NANOG, through a fibroblast growth factor (FGF)-induced MAPK-dependent signaling pathway, and hence attenuates ESC self-renewal and positively regulates mesendoderm differentiation (By similarity). May play a role in mediating pro-apoptotic effects in malignant B-cells by promoting ARE-mediated mRNA decay of BCL2 mRNA (PubMed:25014217). In association with ZFP36L2 maintains quiescence on developing B lymphocytes by promoting ARE-mediated decay of several mRNAs encoding cell cycle regulators that help B cells progress through the cell cycle, and hence ensuring accurate variable-diversity-joining (VDJ) recombination and functional immune cell formation (By similarity). Together with ZFP36L2 is also necessary for thymocyte development and prevention of T-cell acute lymphoblastic leukemia (T-ALL) transformation by promoting ARE-mediated mRNA decay of the oncogenic transcription factor NOTCH1 mRNA (By similarity). Participates in the delivery of target ARE-mRNAs to processing bodies (PBs) (PubMed:17369404). In addition to its cytosolic mRNA-decay function, plays a role in the regulation of nuclear mRNA 3'-end processing; modulates mRNA 3'-end maturation efficiency of the DLL4 mRNA through binding with an ARE embedded in a weak noncanonical polyadenylation (poly(A)) signal in endothelial cells (PubMed:21832157). Also involved in the regulation of stress granule (SG) and P-body (PB) formation and fusion (PubMed:15967811). Plays a role in vasculogenesis and endocardial development (By similarity). Plays a role in the regulation of keratinocyte proliferation, differentiation and apoptosis (PubMed:27182009). Plays a role in myoblast cell differentiation (By similarity). {ECO:0000250|UniProtKB:P17431, ECO:0000250|UniProtKB:P23950, ECO:0000269|PubMed:12198173, ECO:0000269|PubMed:15467755, ECO:0000269|PubMed:15538381, ECO:0000269|PubMed:15687258, ECO:0000269|PubMed:15967811, ECO:0000269|PubMed:17030608, ECO:0000269|PubMed:17369404, ECO:0000269|PubMed:18326031, ECO:0000269|PubMed:19179481, ECO:0000269|PubMed:20702587, ECO:0000269|PubMed:21832157, ECO:0000269|PubMed:24700863, ECO:0000269|PubMed:25014217, ECO:0000269|PubMed:25106868, ECO:0000269|PubMed:26542173, ECO:0000269|PubMed:27182009}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ZFP36 | chr19:39897568 | chr19:2271384 | ENST00000248673 | + | 1 | 2 | 100_326 | 8.0 | 327.0 | Region | Necessary for localization of ARE-containing mRNAs to processing bodies (PBs) |
| Hgene | ZFP36 | chr19:39897568 | chr19:2271384 | ENST00000248673 | + | 1 | 2 | 174_326 | 8.0 | 327.0 | Region | Necessary for mRNA decay activation |
| Hgene | ZFP36 | chr19:39897568 | chr19:2271384 | ENST00000248673 | + | 1 | 2 | 1_100 | 8.0 | 327.0 | Region | Necessary and sufficient for the association with mRNA decay enzymes and mRNA decay activation |
| Hgene | ZFP36 | chr19:39897568 | chr19:2271384 | ENST00000248673 | + | 1 | 2 | 1_15 | 8.0 | 327.0 | Region | Necessary for nuclear export |
| Hgene | ZFP36 | chr19:39897568 | chr19:2271384 | ENST00000248673 | + | 1 | 2 | 1_174 | 8.0 | 327.0 | Region | Necessary for localization of ARE-containing mRNAs to processing bodies (PBs) |
| Hgene | ZFP36 | chr19:39897568 | chr19:2271384 | ENST00000248673 | + | 1 | 2 | 95_168 | 8.0 | 327.0 | Region | Necessary for nuclear localization |
| Hgene | ZFP36 | chr19:39897568 | chr19:2271384 | ENST00000248673 | + | 1 | 2 | 97_173 | 8.0 | 327.0 | Region | Necessary for RNA-binding |
| Hgene | ZFP36 | chr19:39897568 | chr19:2271384 | ENST00000248673 | + | 1 | 2 | 198_202 | 8.0 | 327.0 | Repeat | Note=P-P-P-P-G |
| Hgene | ZFP36 | chr19:39897568 | chr19:2271384 | ENST00000248673 | + | 1 | 2 | 219_223 | 8.0 | 327.0 | Repeat | Note=P-P-P-P-G |
| Hgene | ZFP36 | chr19:39897568 | chr19:2271384 | ENST00000248673 | + | 1 | 2 | 71_75 | 8.0 | 327.0 | Repeat | Note=P-P-P-P-G |
| Hgene | ZFP36 | chr19:39897568 | chr19:2271384 | ENST00000248673 | + | 1 | 2 | 103_131 | 8.0 | 327.0 | Zinc finger | C3H1-type 1 |
| Hgene | ZFP36 | chr19:39897568 | chr19:2271384 | ENST00000248673 | + | 1 | 2 | 141_169 | 8.0 | 327.0 | Zinc finger | C3H1-type 2 |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| ZFP36 | |
| OAZ1 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Hgene | ZFP36 | chr19:39897568 | chr19:2271384 | ENST00000248673 | + | 1 | 2 | 312_326 | 8.0 | 327.0 | CNOT1 |
Top |
Related Drugs to ZFP36-OAZ1 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to ZFP36-OAZ1 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies