| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:BRE-PRKCE |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: BRE-PRKCE | FusionPDB ID: 10242 | FusionGDB2.0 ID: 10242 | Hgene | Tgene | Gene symbol | BRE | PRKCE | Gene ID | 9577 | 5581 |
| Gene name | BRISC and BRCA1 A complex member 2 | protein kinase C epsilon | |
| Synonyms | BRCC4|BRCC45|BRE | PKCE|nPKC-epsilon | |
| Cytomap | 2p23.2 | 2p21 | |
| Type of gene | protein-coding | protein-coding | |
| Description | BRISC and BRCA1-A complex member 2BRCA1-A complex subunit BREBRCA1/BRCA2-containing complex subunit 45BRCA1/BRCA2-containing complex, subunit 4brain and reproductive organ-expressed (TNFRSF1A modulator)brain and reproductive organ-expressed protein | protein kinase C epsilon type | |
| Modification date | 20200313 | 20200327 | |
| UniProtAcc | . | Q02156 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000342045, ENST00000344773, ENST00000361704, ENST00000379624, ENST00000379632, ENST00000603461, | ENST00000394874, ENST00000467135, ENST00000306156, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 13 X 9 X 8=936 | 11 X 12 X 7=924 |
| # samples | 15 | 12 | |
| ** MAII score | log2(15/936*10)=-2.64154602908752 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(12/924*10)=-2.94485844580754 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: BRE [Title/Abstract] AND PRKCE [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | BRE(28268666)-PRKCE(46313347), # samples:3 | ||
| Anticipated loss of major functional domain due to fusion event. | BRE-PRKCE seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. BRE-PRKCE seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. BRE-PRKCE seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. BRE-PRKCE seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | BRE | GO:0043066 | negative regulation of apoptotic process | 15465831 |
| Tgene | PRKCE | GO:0006468 | protein phosphorylation | 18556656 |
| Tgene | PRKCE | GO:0018105 | peptidyl-serine phosphorylation | 15695813 |
| Fusion gene breakpoints across BRE (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across PRKCE (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BRCA | TCGA-C8-A134-01A | BRE | chr2 | 28268666 | - | PRKCE | chr2 | 46313347 | + |
| ChimerDB4 | BRCA | TCGA-C8-A134-01A | BRE | chr2 | 28268666 | + | PRKCE | chr2 | 46313347 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000344773 | BRE | chr2 | 28268666 | + | ENST00000306156 | PRKCE | chr2 | 46313347 | + | 4594 | 708 | 138 | 1484 | 448 |
| ENST00000379624 | BRE | chr2 | 28268666 | + | ENST00000306156 | PRKCE | chr2 | 46313347 | + | 4573 | 687 | 117 | 1463 | 448 |
| ENST00000342045 | BRE | chr2 | 28268666 | + | ENST00000306156 | PRKCE | chr2 | 46313347 | + | 4597 | 711 | 141 | 1487 | 448 |
| ENST00000379632 | BRE | chr2 | 28268666 | + | ENST00000306156 | PRKCE | chr2 | 46313347 | + | 4596 | 710 | 140 | 1486 | 448 |
| ENST00000361704 | BRE | chr2 | 28268666 | + | ENST00000306156 | PRKCE | chr2 | 46313347 | + | 4530 | 644 | 74 | 1420 | 448 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000344773 | ENST00000306156 | BRE | chr2 | 28268666 | + | PRKCE | chr2 | 46313347 | + | 0.000223038 | 0.999777 |
| ENST00000379624 | ENST00000306156 | BRE | chr2 | 28268666 | + | PRKCE | chr2 | 46313347 | + | 0.000216316 | 0.9997837 |
| ENST00000342045 | ENST00000306156 | BRE | chr2 | 28268666 | + | PRKCE | chr2 | 46313347 | + | 0.000207263 | 0.99979275 |
| ENST00000379632 | ENST00000306156 | BRE | chr2 | 28268666 | + | PRKCE | chr2 | 46313347 | + | 0.000207236 | 0.99979275 |
| ENST00000361704 | ENST00000306156 | BRE | chr2 | 28268666 | + | PRKCE | chr2 | 46313347 | + | 0.000218069 | 0.9997819 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >10242_10242_1_BRE-PRKCE_BRE_chr2_28268666_ENST00000342045_PRKCE_chr2_46313347_ENST00000306156_length(amino acids)=448AA_BP=190 MSPEVALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDA EFLPDPSALQNLASWNPSNPECLLLVVKELVQQYHQFQCSRLRESSRLMFEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVD FSNIPTYLLKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGIL NGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKR -------------------------------------------------------------- >10242_10242_2_BRE-PRKCE_BRE_chr2_28268666_ENST00000344773_PRKCE_chr2_46313347_ENST00000306156_length(amino acids)=448AA_BP=190 MSPEVALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDA EFLPDPSALQNLASWNPSNPECLLLVVKELVQQYHQFQCSRLRESSRLMFEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVD FSNIPTYLLKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGIL NGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKR -------------------------------------------------------------- >10242_10242_3_BRE-PRKCE_BRE_chr2_28268666_ENST00000361704_PRKCE_chr2_46313347_ENST00000306156_length(amino acids)=448AA_BP=190 MSPEVALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDA EFLPDPSALQNLASWNPSNPECLLLVVKELVQQYHQFQCSRLRESSRLMFEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVD FSNIPTYLLKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGIL NGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKR -------------------------------------------------------------- >10242_10242_4_BRE-PRKCE_BRE_chr2_28268666_ENST00000379624_PRKCE_chr2_46313347_ENST00000306156_length(amino acids)=448AA_BP=190 MSPEVALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDA EFLPDPSALQNLASWNPSNPECLLLVVKELVQQYHQFQCSRLRESSRLMFEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVD FSNIPTYLLKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGIL NGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKR -------------------------------------------------------------- >10242_10242_5_BRE-PRKCE_BRE_chr2_28268666_ENST00000379632_PRKCE_chr2_46313347_ENST00000306156_length(amino acids)=448AA_BP=190 MSPEVALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDA EFLPDPSALQNLASWNPSNPECLLLVVKELVQQYHQFQCSRLRESSRLMFEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVD FSNIPTYLLKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGIL NGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKR -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:28268666/chr2:46313347) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| . | PRKCE |
| FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. | FUNCTION: Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that plays essential roles in the regulation of multiple cellular processes linked to cytoskeletal proteins, such as cell adhesion, motility, migration and cell cycle, functions in neuron growth and ion channel regulation, and is involved in immune response, cancer cell invasion and regulation of apoptosis. Mediates cell adhesion to the extracellular matrix via integrin-dependent signaling, by mediating angiotensin-2-induced activation of integrin beta-1 (ITGB1) in cardiac fibroblasts. Phosphorylates MARCKS, which phosphorylates and activates PTK2/FAK, leading to the spread of cardiomyocytes. Involved in the control of the directional transport of ITGB1 in mesenchymal cells by phosphorylating vimentin (VIM), an intermediate filament (IF) protein. In epithelial cells, associates with and phosphorylates keratin-8 (KRT8), which induces targeting of desmoplakin at desmosomes and regulates cell-cell contact. Phosphorylates IQGAP1, which binds to CDC42, mediating epithelial cell-cell detachment prior to migration. In HeLa cells, contributes to hepatocyte growth factor (HGF)-induced cell migration, and in human corneal epithelial cells, plays a critical role in wound healing after activation by HGF. During cytokinesis, forms a complex with YWHAB, which is crucial for daughter cell separation, and facilitates abscission by a mechanism which may implicate the regulation of RHOA. In cardiac myocytes, regulates myofilament function and excitation coupling at the Z-lines, where it is indirectly associated with F-actin via interaction with COPB1. During endothelin-induced cardiomyocyte hypertrophy, mediates activation of PTK2/FAK, which is critical for cardiomyocyte survival and regulation of sarcomere length. Plays a role in the pathogenesis of dilated cardiomyopathy via persistent phosphorylation of troponin I (TNNI3). Involved in nerve growth factor (NFG)-induced neurite outgrowth and neuron morphological change independently of its kinase activity, by inhibition of RHOA pathway, activation of CDC42 and cytoskeletal rearrangement. May be involved in presynaptic facilitation by mediating phorbol ester-induced synaptic potentiation. Phosphorylates gamma-aminobutyric acid receptor subunit gamma-2 (GABRG2), which reduces the response of GABA receptors to ethanol and benzodiazepines and may mediate acute tolerance to the intoxicating effects of ethanol. Upon PMA treatment, phosphorylates the capsaicin- and heat-activated cation channel TRPV1, which is required for bradykinin-induced sensitization of the heat response in nociceptive neurons. Is able to form a complex with PDLIM5 and N-type calcium channel, and may enhance channel activities and potentiates fast synaptic transmission by phosphorylating the pore-forming alpha subunit CACNA1B (CaV2.2). In prostate cancer cells, interacts with and phosphorylates STAT3, which increases DNA-binding and transcriptional activity of STAT3 and seems to be essential for prostate cancer cell invasion. Downstream of TLR4, plays an important role in the lipopolysaccharide (LPS)-induced immune response by phosphorylating and activating TICAM2/TRAM, which in turn activates the transcription factor IRF3 and subsequent cytokines production. In differentiating erythroid progenitors, is regulated by EPO and controls the protection against the TNFSF10/TRAIL-mediated apoptosis, via BCL2. May be involved in the regulation of the insulin-induced phosphorylation and activation of AKT1. Phosphorylates NLRP5/MATER and may thereby modulate AKT pathway activation in cumulus cells (PubMed:19542546). {ECO:0000269|PubMed:11884385, ECO:0000269|PubMed:1374067, ECO:0000269|PubMed:15355962, ECO:0000269|PubMed:16757566, ECO:0000269|PubMed:17603037, ECO:0000269|PubMed:17875639, ECO:0000269|PubMed:17875724, ECO:0000269|PubMed:19542546}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | BRE | chr2:28268666 | chr2:46313347 | ENST00000342045 | + | 7 | 13 | 30_147 | 190.0 | 384.0 | Region | Note=UEV-like 1 |
| Hgene | BRE | chr2:28268666 | chr2:46313347 | ENST00000344773 | + | 6 | 13 | 30_147 | 190.0 | 528.6666666666666 | Region | Note=UEV-like 1 |
| Hgene | BRE | chr2:28268666 | chr2:46313347 | ENST00000361704 | + | 6 | 13 | 30_147 | 190.0 | 511.0 | Region | Note=UEV-like 1 |
| Hgene | BRE | chr2:28268666 | chr2:46313347 | ENST00000379624 | + | 6 | 12 | 30_147 | 190.0 | 384.0 | Region | Note=UEV-like 1 |
| Hgene | BRE | chr2:28268666 | chr2:46313347 | ENST00000379632 | + | 7 | 14 | 30_147 | 190.0 | 511.0 | Region | Note=UEV-like 1 |
| Tgene | PRKCE | chr2:28268666 | chr2:46313347 | ENST00000306156 | 9 | 15 | 669_737 | 479.0 | 738.0 | Domain | AGC-kinase C-terminal |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | BRE | chr2:28268666 | chr2:46313347 | ENST00000342045 | + | 7 | 13 | 275_364 | 190.0 | 384.0 | Region | Note=UEV-like 2 |
| Hgene | BRE | chr2:28268666 | chr2:46313347 | ENST00000344773 | + | 6 | 13 | 275_364 | 190.0 | 528.6666666666666 | Region | Note=UEV-like 2 |
| Hgene | BRE | chr2:28268666 | chr2:46313347 | ENST00000361704 | + | 6 | 13 | 275_364 | 190.0 | 511.0 | Region | Note=UEV-like 2 |
| Hgene | BRE | chr2:28268666 | chr2:46313347 | ENST00000379624 | + | 6 | 12 | 275_364 | 190.0 | 384.0 | Region | Note=UEV-like 2 |
| Hgene | BRE | chr2:28268666 | chr2:46313347 | ENST00000379632 | + | 7 | 14 | 275_364 | 190.0 | 511.0 | Region | Note=UEV-like 2 |
| Tgene | PRKCE | chr2:28268666 | chr2:46313347 | ENST00000306156 | 9 | 15 | 1_117 | 479.0 | 738.0 | Domain | C2 | |
| Tgene | PRKCE | chr2:28268666 | chr2:46313347 | ENST00000306156 | 9 | 15 | 408_668 | 479.0 | 738.0 | Domain | Protein kinase | |
| Tgene | PRKCE | chr2:28268666 | chr2:46313347 | ENST00000306156 | 9 | 15 | 414_422 | 479.0 | 738.0 | Nucleotide binding | ATP | |
| Tgene | PRKCE | chr2:28268666 | chr2:46313347 | ENST00000306156 | 9 | 15 | 169_220 | 479.0 | 738.0 | Zinc finger | Phorbol-ester/DAG-type 1 | |
| Tgene | PRKCE | chr2:28268666 | chr2:46313347 | ENST00000306156 | 9 | 15 | 242_292 | 479.0 | 738.0 | Zinc finger | Phorbol-ester/DAG-type 2 |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| BRE | |
| PRKCE |  |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to BRE-PRKCE |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to BRE-PRKCE |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Tgene | PRKCE | C0020429 | Hyperalgesia | 3 | CTD_human |
| Tgene | PRKCE | C0458247 | Allodynia | 3 | CTD_human |
| Tgene | PRKCE | C0751211 | Hyperalgesia, Primary | 3 | CTD_human |
| Tgene | PRKCE | C0751212 | Hyperalgesia, Secondary | 3 | CTD_human |
| Tgene | PRKCE | C0751213 | Tactile Allodynia | 3 | CTD_human |
| Tgene | PRKCE | C0751214 | Hyperalgesia, Thermal | 3 | CTD_human |
| Tgene | PRKCE | C2936719 | Mechanical Allodynia | 3 | CTD_human |
| Tgene | PRKCE | C0002152 | Alloxan Diabetes | 1 | CTD_human |
| Tgene | PRKCE | C0009402 | Colorectal Carcinoma | 1 | CTD_human;UNIPROT |
| Tgene | PRKCE | C0009404 | Colorectal Neoplasms | 1 | CTD_human |
| Tgene | PRKCE | C0011853 | Diabetes Mellitus, Experimental | 1 | CTD_human |
| Tgene | PRKCE | C0011881 | Diabetic Nephropathy | 1 | CTD_human |
| Tgene | PRKCE | C0013146 | Drug abuse | 1 | CTD_human |
| Tgene | PRKCE | C0013170 | Drug habituation | 1 | CTD_human |
| Tgene | PRKCE | C0013222 | Drug Use Disorders | 1 | CTD_human |
| Tgene | PRKCE | C0017667 | Nodular glomerulosclerosis | 1 | CTD_human |
| Tgene | PRKCE | C0023903 | Liver neoplasms | 1 | CTD_human |
| Tgene | PRKCE | C0027051 | Myocardial Infarction | 1 | CTD_human |
| Tgene | PRKCE | C0029231 | Organic Mental Disorders, Substance-Induced | 1 | CTD_human |
| Tgene | PRKCE | C0033141 | Cardiomyopathies, Primary | 1 | CTD_human |
| Tgene | PRKCE | C0036529 | Myocardial Diseases, Secondary | 1 | CTD_human |
| Tgene | PRKCE | C0038433 | Streptozotocin Diabetes | 1 | CTD_human |
| Tgene | PRKCE | C0038580 | Substance Dependence | 1 | CTD_human |
| Tgene | PRKCE | C0038586 | Substance Use Disorders | 1 | CTD_human |
| Tgene | PRKCE | C0151744 | Myocardial Ischemia | 1 | CTD_human |
| Tgene | PRKCE | C0236969 | Substance-Related Disorders | 1 | CTD_human |
| Tgene | PRKCE | C0242231 | Coronary Stenosis | 1 | CTD_human |
| Tgene | PRKCE | C0345904 | Malignant neoplasm of liver | 1 | CTD_human |
| Tgene | PRKCE | C0400966 | Non-alcoholic Fatty Liver Disease | 1 | CTD_human |
| Tgene | PRKCE | C0740858 | Substance abuse problem | 1 | CTD_human |
| Tgene | PRKCE | C0878544 | Cardiomyopathies | 1 | CTD_human |
| Tgene | PRKCE | C1510472 | Drug Dependence | 1 | CTD_human |
| Tgene | PRKCE | C3241937 | Nonalcoholic Steatohepatitis | 1 | CTD_human |
| Tgene | PRKCE | C4316881 | Prescription Drug Abuse | 1 | CTD_human |
| Tgene | PRKCE | C4721453 | Peripheral Nervous System Diseases | 1 | CTD_human |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies