UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Fusion Protein:CLU-MYH9 |
Fusion Protein Summary |
Fusion gene summary |
Fusion partner gene information | Fusion gene name: CLU-MYH9 | FusionPDB ID: 17454 | FusionGDB2.0 ID: 17454 | Hgene | Tgene | Gene symbol | CLU | MYH9 | Gene ID | 1191 | 4627 |
Gene name | clusterin | myosin heavy chain 9 | |
Synonyms | AAG4|APO-J|APOJ|CLI|CLU1|CLU2|KUB1|NA1/NA2|SGP-2|SGP2|SP-40|TRPM-2|TRPM2 | BDPLT6|DFNA17|EPSTS|FTNS|MATINS|MHA|NMHC-II-A|NMMHC-IIA|NMMHCA | |
Cytomap | 8p21.1 | 22q12.3 | |
Type of gene | protein-coding | protein-coding | |
Description | clusterinaging-associated protein 4apolipoprotein Jcomplement cytolysis inhibitorcomplement lysis inhibitorcomplement-associated protein SP-40,40epididymis secretory sperm binding proteinku70-binding protein 1sulfated glycoprotein 2testosterone-r | myosin-9cellular myosin heavy chain, type Amyosin, heavy chain 9, non-musclenon-muscle myosin heavy chain 9non-muscle myosin heavy chain Anon-muscle myosin heavy chain IIanon-muscle myosin heavy polypeptide 9nonmuscle myosin heavy chain II-A | |
Modification date | 20200327 | 20200315 | |
UniProtAcc | Q15846 | P35579 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000316403, ENST00000405140, ENST00000523500, ENST00000546343, ENST00000560366, | ENST00000401701, ENST00000475726, ENST00000216181, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 38 X 38 X 12=17328 | 44 X 46 X 15=30360 |
# samples | 49 | 56 | |
** MAII score | log2(49/17328*10)=-5.14417958860576 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(56/30360*10)=-5.76060115335786 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: CLU [Title/Abstract] AND MYH9 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CLU(27463871)-MYH9(36723533), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | CLU-MYH9 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CLU-MYH9 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CLU-MYH9 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CLU-MYH9 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CLU-MYH9 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. CLU-MYH9 seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. CLU-MYH9 seems lost the major protein functional domain in Tgene partner, which is a tumor suppressor due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | CLU | GO:0000902 | cell morphogenesis | 15857407 |
Hgene | CLU | GO:0001774 | microglial cell activation | 15857407 |
Hgene | CLU | GO:0017038 | protein import | 24446231 |
Hgene | CLU | GO:0031333 | negative regulation of protein complex assembly | 22179788|23106396 |
Hgene | CLU | GO:0031334 | positive regulation of protein complex assembly | 22179788 |
Hgene | CLU | GO:0032760 | positive regulation of tumor necrosis factor production | 15857407 |
Hgene | CLU | GO:0045429 | positive regulation of nitric oxide biosynthetic process | 15857407 |
Hgene | CLU | GO:0050821 | protein stabilization | 11123922|12176985 |
Hgene | CLU | GO:0051131 | chaperone-mediated protein complex assembly | 17412999 |
Hgene | CLU | GO:0051788 | response to misfolded protein | 19996109 |
Hgene | CLU | GO:0061077 | chaperone-mediated protein folding | 11123922 |
Hgene | CLU | GO:0061518 | microglial cell proliferation | 15857407 |
Hgene | CLU | GO:1900221 | regulation of amyloid-beta clearance | 24446231 |
Hgene | CLU | GO:1901214 | regulation of neuron death | 17412999 |
Hgene | CLU | GO:1901216 | positive regulation of neuron death | 15857407 |
Hgene | CLU | GO:1902430 | negative regulation of amyloid-beta formation | 12047389|17412999 |
Hgene | CLU | GO:1905907 | negative regulation of amyloid fibril formation | 22179788 |
Tgene | MYH9 | GO:0001525 | angiogenesis | 16403913 |
Tgene | MYH9 | GO:0001778 | plasma membrane repair | 27325790 |
Tgene | MYH9 | GO:0006509 | membrane protein ectodomain proteolysis | 16186248 |
Tgene | MYH9 | GO:0030048 | actin filament-based movement | 12237319|15845534 |
Tgene | MYH9 | GO:0031032 | actomyosin structure organization | 24072716 |
Fusion gene breakpoints across CLU (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across MYH9 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BLCA | TCGA-UY-A9PE-01A | CLU | chr8 | 27463871 | - | MYH9 | chr22 | 36723533 | - |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000405140 | CLU | chr8 | 27463871 | - | ENST00000216181 | MYH9 | chr22 | 36723533 | - | 7512 | 732 | 659 | 6124 | 1821 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000405140 | ENST00000216181 | CLU | chr8 | 27463871 | - | MYH9 | chr22 | 36723533 | - | 0.021101424 | 0.9788986 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >17454_17454_1_CLU-MYH9_CLU_chr8_27463871_ENST00000405140_MYH9_chr22_36723533_ENST00000216181_length(amino acids)=1821AA_BP=24 MPETDLHEVLRTRLQKWLRPGWPPDREDQSILCTGESGAGKTENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKN DNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKYRFLSNGHVTIPGQQDKDMF QETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNTDQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQ ADFAIEALAKATYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEW NFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKSFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNM DPLNDNIATLLHQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKK AGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRYEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLA HLEEERDLKITDVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQVSRQEEEMMAKEEELVKVRE KQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAEELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELE EQLEEEESARQKLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAKLKNKHEAMITDLEERLRRE EKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNK AEKQKRDLGEELEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAK QTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQ LQDTQELLQEENRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQ RHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAM EQKAELERLNKQFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVNLQAMKAQFERDLQGRDEQ SEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLKDLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAK ENEKKLKSMEAEMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEEQGNTELINDRLKKANLQI DQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTVKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLL QVDDERRNAEQYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGA -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr8:27463871/chr22:36723533) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
CLU | MYH9 |
FUNCTION: Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. Promotes also cell motility together with S100A4 (PubMed:16707441). During cell spreading, plays an important role in cytoskeleton reorganization, focal contacts formation (in the margins but not the central part of spreading cells), and lamellipodial retraction; this function is mechanically antagonized by MYH10 (PubMed:20052411). {ECO:0000250|UniProtKB:Q8VDD5, ECO:0000269|PubMed:16707441, ECO:0000269|PubMed:20052411}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CLU | chr8:27463871 | chr22:36723533 | ENST00000316403 | - | 4 | 9 | 78_81 | 139.0 | 450.0 | Motif | Nuclear localization signal |
Hgene | CLU | chr8:27463871 | chr22:36723533 | ENST00000405140 | - | 4 | 9 | 78_81 | 139.0 | 450.0 | Motif | Nuclear localization signal |
Hgene | CLU | chr8:27463871 | chr22:36723533 | ENST00000523500 | - | 3 | 8 | 78_81 | 139.0 | 450.0 | Motif | Nuclear localization signal |
Hgene | CLU | chr8:27463871 | chr22:36723533 | ENST00000546343 | - | 4 | 9 | 78_81 | 150.0 | 461.0 | Motif | Nuclear localization signal |
Hgene | CLU | chr8:27463871 | chr22:36723533 | ENST00000560366 | - | 4 | 9 | 78_81 | 191.0 | 502.0 | Motif | Nuclear localization signal |
Tgene | MYH9 | chr8:27463871 | chr22:36723533 | ENST00000216181 | 2 | 41 | 837_1926 | 163.33333333333334 | 1961.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | MYH9 | chr8:27463871 | chr22:36723533 | ENST00000216181 | 2 | 41 | 779_808 | 163.33333333333334 | 1961.0 | Domain | IQ | |
Tgene | MYH9 | chr8:27463871 | chr22:36723533 | ENST00000216181 | 2 | 41 | 174_181 | 163.33333333333334 | 1961.0 | Nucleotide binding | ATP | |
Tgene | MYH9 | chr8:27463871 | chr22:36723533 | ENST00000216181 | 2 | 41 | 654_676 | 163.33333333333334 | 1961.0 | Region | Note=Actin-binding |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CLU | chr8:27463871 | chr22:36723533 | ENST00000316403 | - | 4 | 9 | 443_447 | 139.0 | 450.0 | Motif | Nuclear localization signal |
Hgene | CLU | chr8:27463871 | chr22:36723533 | ENST00000405140 | - | 4 | 9 | 443_447 | 139.0 | 450.0 | Motif | Nuclear localization signal |
Hgene | CLU | chr8:27463871 | chr22:36723533 | ENST00000523500 | - | 3 | 8 | 443_447 | 139.0 | 450.0 | Motif | Nuclear localization signal |
Hgene | CLU | chr8:27463871 | chr22:36723533 | ENST00000546343 | - | 4 | 9 | 443_447 | 150.0 | 461.0 | Motif | Nuclear localization signal |
Hgene | CLU | chr8:27463871 | chr22:36723533 | ENST00000560366 | - | 4 | 9 | 443_447 | 191.0 | 502.0 | Motif | Nuclear localization signal |
Tgene | MYH9 | chr8:27463871 | chr22:36723533 | ENST00000216181 | 2 | 41 | 27_77 | 163.33333333333334 | 1961.0 | Domain | Myosin N-terminal SH3-like | |
Tgene | MYH9 | chr8:27463871 | chr22:36723533 | ENST00000216181 | 2 | 41 | 81_776 | 163.33333333333334 | 1961.0 | Domain | Myosin motor |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
Gene | STRING network |
CLU | |
MYH9 |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to CLU-MYH9 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to CLU-MYH9 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Hgene | CLU | C0022660 | Kidney Failure, Acute | 6 | CTD_human |
Hgene | CLU | C1565662 | Acute Kidney Insufficiency | 6 | CTD_human |
Hgene | CLU | C2609414 | Acute kidney injury | 6 | CTD_human |
Hgene | CLU | C0002395 | Alzheimer's Disease | 3 | CTD_human |
Hgene | CLU | C0011265 | Presenile dementia | 3 | CTD_human |
Hgene | CLU | C0022658 | Kidney Diseases | 3 | CTD_human |
Hgene | CLU | C0276496 | Familial Alzheimer Disease (FAD) | 3 | CTD_human |
Hgene | CLU | C0494463 | Alzheimer Disease, Late Onset | 3 | CTD_human |
Hgene | CLU | C0546126 | Acute Confusional Senile Dementia | 3 | CTD_human |
Hgene | CLU | C0750900 | Alzheimer's Disease, Focal Onset | 3 | CTD_human |
Hgene | CLU | C0750901 | Alzheimer Disease, Early Onset | 3 | CTD_human |
Hgene | CLU | C0013221 | Drug toxicity | 2 | CTD_human |
Hgene | CLU | C0029408 | Degenerative polyarthritis | 2 | CTD_human |
Hgene | CLU | C0041755 | Adverse reaction to drug | 2 | CTD_human |
Hgene | CLU | C0086743 | Osteoarthrosis Deformans | 2 | CTD_human |
Hgene | CLU | C0019193 | Hepatitis, Toxic | 1 | CTD_human |
Hgene | CLU | C0022333 | Jacksonian Seizure | 1 | CTD_human |
Hgene | CLU | C0024141 | Lupus Erythematosus, Systemic | 1 | CTD_human |
Hgene | CLU | C0025202 | melanoma | 1 | CTD_human |
Hgene | CLU | C0027686 | Pathologic Neovascularization | 1 | CTD_human |
Hgene | CLU | C0033578 | Prostatic Neoplasms | 1 | CTD_human |
Hgene | CLU | C0036341 | Schizophrenia | 1 | PSYGENET |
Hgene | CLU | C0036572 | Seizures | 1 | CTD_human |
Hgene | CLU | C0087031 | Juvenile-Onset Still Disease | 1 | CTD_human |
Hgene | CLU | C0149958 | Complex partial seizures | 1 | CTD_human |
Hgene | CLU | C0234533 | Generalized seizures | 1 | CTD_human |
Hgene | CLU | C0234535 | Clonic Seizures | 1 | CTD_human |
Hgene | CLU | C0234985 | Mental deterioration | 1 | CTD_human |
Hgene | CLU | C0242380 | Libman-Sacks Disease | 1 | CTD_human |
Hgene | CLU | C0270824 | Visual seizure | 1 | CTD_human |
Hgene | CLU | C0270844 | Tonic Seizures | 1 | CTD_human |
Hgene | CLU | C0270846 | Epileptic drop attack | 1 | CTD_human |
Hgene | CLU | C0333641 | Atrophic | 1 | CTD_human |
Hgene | CLU | C0338656 | Impaired cognition | 1 | CTD_human |
Hgene | CLU | C0376358 | Malignant neoplasm of prostate | 1 | CTD_human |
Hgene | CLU | C0422850 | Seizures, Somatosensory | 1 | CTD_human |
Hgene | CLU | C0422852 | Seizures, Auditory | 1 | CTD_human |
Hgene | CLU | C0422853 | Olfactory seizure | 1 | CTD_human |
Hgene | CLU | C0422854 | Gustatory seizure | 1 | CTD_human |
Hgene | CLU | C0422855 | Vertiginous seizure | 1 | CTD_human |
Hgene | CLU | C0494475 | Tonic - clonic seizures | 1 | CTD_human |
Hgene | CLU | C0751056 | Non-epileptic convulsion | 1 | CTD_human |
Hgene | CLU | C0751110 | Single Seizure | 1 | CTD_human |
Hgene | CLU | C0751123 | Atonic Absence Seizures | 1 | CTD_human |
Hgene | CLU | C0751494 | Convulsive Seizures | 1 | CTD_human |
Hgene | CLU | C0751495 | Seizures, Focal | 1 | CTD_human |
Hgene | CLU | C0751496 | Seizures, Sensory | 1 | CTD_human |
Hgene | CLU | C0860207 | Drug-Induced Liver Disease | 1 | CTD_human |
Hgene | CLU | C1262760 | Hepatitis, Drug-Induced | 1 | CTD_human |
Hgene | CLU | C1270972 | Mild cognitive disorder | 1 | CTD_human |
Hgene | CLU | C1862939 | AMYOTROPHIC LATERAL SCLEROSIS 1 | 1 | CTD_human |
Hgene | CLU | C1862941 | Amyotrophic Lateral Sclerosis, Sporadic | 1 | CTD_human |
Hgene | CLU | C3495559 | Juvenile arthritis | 1 | CTD_human |
Hgene | CLU | C3495874 | Nonepileptic Seizures | 1 | CTD_human |
Hgene | CLU | C3658290 | Drug-Induced Acute Liver Injury | 1 | CTD_human |
Hgene | CLU | C3714758 | Juvenile psoriatic arthritis | 1 | CTD_human |
Hgene | CLU | C4048158 | Convulsions | 1 | CTD_human |
Hgene | CLU | C4277682 | Chemical and Drug Induced Liver Injury | 1 | CTD_human |
Hgene | CLU | C4279912 | Chemically-Induced Liver Toxicity | 1 | CTD_human |
Hgene | CLU | C4316903 | Absence Seizures | 1 | CTD_human |
Hgene | CLU | C4317109 | Epileptic Seizures | 1 | CTD_human |
Hgene | CLU | C4317123 | Myoclonic Seizures | 1 | CTD_human |
Hgene | CLU | C4505436 | Generalized Absence Seizures | 1 | CTD_human |
Hgene | CLU | C4551993 | Amyotrophic Lateral Sclerosis, Familial | 1 | CTD_human |
Hgene | CLU | C4552091 | Polyarthritis, Juvenile, Rheumatoid Factor Negative | 1 | CTD_human |
Hgene | CLU | C4704862 | Polyarthritis, Juvenile, Rheumatoid Factor Positive | 1 | CTD_human |