UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:CPQ-SDC2 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: CPQ-SDC2 | FusionPDB ID: 19085 | FusionGDB2.0 ID: 19085 | Hgene | Tgene | Gene symbol | CPQ | SDC2 | Gene ID | 10404 | 6383 |
Gene name | carboxypeptidase Q | syndecan 2 | |
Synonyms | LDP|PGCP | CD362|HSPG|HSPG1|SYND2 | |
Cytomap | 8q22.1 | 8q22.1 | |
Type of gene | protein-coding | protein-coding | |
Description | carboxypeptidase QSer-Met dipeptidaseaminopeptidaseblood plasma glutamate carboxypeptidaselysosomal dipeptidase | syndecan-2cell surface-associated heparan sulfate proteoglycan 1fibroglycanheparan sulfate proteoglycan 1, cell surface-associatedheparan sulfate proteoglycan core proteinsyndecan proteoglycan 2 | |
Modification date | 20200313 | 20200322 | |
UniProtAcc | Q9Y646 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000220763, ENST00000529551, | ENST00000519914, ENST00000522911, ENST00000518385, ENST00000520233, ENST00000302190, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 12 X 7 X 9=756 | 9 X 7 X 7=441 |
# samples | 13 | 13 | |
** MAII score | log2(13/756*10)=-2.53987461119262 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(13/441*10)=-1.76226703252907 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: CPQ [Title/Abstract] AND SDC2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CPQ(97657630)-SDC2(97605708), # samples:6 SDC2(97506559)-CPQ(97978163), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | CPQ-SDC2 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. CPQ-SDC2 seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. SDC2-CPQ seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. SDC2-CPQ seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | CPQ | GO:0006508 | proteolysis | 10206990 |
Hgene | CPQ | GO:0043171 | peptide catabolic process | 10206990 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BRCA | TCGA-A8-A09N-01A | CPQ | chr8 | 98041722 | + | SDC2 | chr8 | 97621613 | + |
ChimerDB4 | KICH | TCGA-KN-8418-01A | CPQ | chr8 | 97657630 | + | SDC2 | chr8 | 97605708 | + |
ChimerDB4 | KIRC | TCGA-AK-3445-01A | CPQ | chr8 | 97657630 | + | SDC2 | chr8 | 97605708 | + |
ChimerDB4 | KIRC | TCGA-BP-4775-01A | CPQ | chr8 | 97892233 | + | SDC2 | chr8 | 97605708 | + |
ChimerDB4 | LIHC | TCGA-XR-A8TC-01A | CPQ | chr8 | 97657630 | + | SDC2 | chr8 | 97605708 | + |
ChimerDB4 | LIHC | TCGA-ZS-A9CD-01A | CPQ | chr8 | 97657630 | + | SDC2 | chr8 | 97605708 | + |
ChimerDB4 | LIHC | TCGA-ZS-A9CF-02A | CPQ | chr8 | 97657630 | + | SDC2 | chr8 | 97605708 | + |
ChimerDB4 | SKCM | TCGA-DA-A1I8-06A | CPQ | chr8 | 97892233 | + | SDC2 | chr8 | 97605708 | + |
ChimerDB4 | THCA | TCGA-J8-A4HW-06A | CPQ | chr8 | 97657630 | + | SDC2 | chr8 | 97605708 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000220763 | CPQ | chr8 | 97892233 | + | ENST00000302190 | SDC2 | chr8 | 97605708 | + | 3829 | 1059 | 198 | 1604 | 468 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000220763 | ENST00000302190 | CPQ | chr8 | 97892233 | + | SDC2 | chr8 | 97605708 | + | 0.000261577 | 0.9997384 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >19085_19085_1_CPQ-SDC2_CPQ_chr8_97892233_ENST00000220763_SDC2_chr8_97605708_ENST00000302190_length(amino acids)=468AA_BP=286 MEKKMKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALLVDTVGPRLSGSKNLEK AIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIGTPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQP YINYSRTVQYRTQGAVEAAKVGALASLIRSVASFSIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDT DSFNTVAEITGSKYPEQRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNI QNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGE -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr8:97657630/chr8:97605708) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
CPQ | . |
FUNCTION: Carboxypeptidase that may play an important role in the hydrolysis of circulating peptides. Catalyzes the hydrolysis of dipeptides with unsubstituted terminals into amino acids. May play a role in the liberation of thyroxine hormone from its thyroglobulin (Tg) precursor. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | SDC2 | chr8:97892233 | chr8:97605708 | ENST00000302190 | 0 | 5 | 170_201 | 20.0 | 202.0 | Topological domain | Cytoplasmic | |
Tgene | SDC2 | chr8:97892233 | chr8:97605708 | ENST00000302190 | 0 | 5 | 19_144 | 20.0 | 202.0 | Topological domain | Extracellular | |
Tgene | SDC2 | chr8:97892233 | chr8:97605708 | ENST00000302190 | 0 | 5 | 145_169 | 20.0 | 202.0 | Transmembrane | Helical |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
CPQ | |
SDC2 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to CPQ-SDC2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to CPQ-SDC2 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |