| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:ADAM17-ITGB1BP1 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: ADAM17-ITGB1BP1 | FusionPDB ID: 1977 | FusionGDB2.0 ID: 1977 | Hgene | Tgene | Gene symbol | ADAM17 | ITGB1BP1 | Gene ID | 6868 | 9270 |
| Gene name | ADAM metallopeptidase domain 17 | integrin subunit beta 1 binding protein 1 | |
| Synonyms | ADAM18|CD156B|CSVP|NISBD|NISBD1|TACE | ICAP-1A|ICAP-1B|ICAP-1alpha|ICAP1|ICAP1A|ICAP1B | |
| Cytomap | 2p25.1 | 2p25.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | disintegrin and metalloproteinase domain-containing protein 17ADAM metallopeptidase domain 18TNF-alpha convertaseTNF-alpha converting enzymesnake venom-like proteasetumor necrosis factor, alpha, converting enzyme | integrin beta-1-binding protein 1bodeninintegrin cytoplasmic domain-associated protein 1integrin cytoplasmic domain-associated protein 1-alphaintegrin cytoplasmic domain-associated protein 1-beta | |
| Modification date | 20200320 | 20200313 | |
| UniProtAcc | P78536 | O14713 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000310823, ENST00000497134, | ENST00000238091, ENST00000355346, ENST00000359712, ENST00000360635, ENST00000456913, ENST00000488451, ENST00000490426, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 6 X 8 X 6=288 | 4 X 4 X 3=48 |
| # samples | 11 | 5 | |
| ** MAII score | log2(11/288*10)=-1.38856528791765 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(5/48*10)=0.0588936890535686 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: ADAM17 [Title/Abstract] AND ITGB1BP1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ADAM17(9695638)-ITGB1BP1(9558861), # samples:2 | ||
| Anticipated loss of major functional domain due to fusion event. | ADAM17-ITGB1BP1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ADAM17-ITGB1BP1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ADAM17-ITGB1BP1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ADAM17-ITGB1BP1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | ADAM17 | GO:0001666 | response to hypoxia | 18276953 |
| Hgene | ADAM17 | GO:0006508 | proteolysis | 24227843 |
| Hgene | ADAM17 | GO:0006509 | membrane protein ectodomain proteolysis | 9034190|9574564|17786981|18676862 |
| Hgene | ADAM17 | GO:0007155 | cell adhesion | 14970227 |
| Hgene | ADAM17 | GO:0007173 | epidermal growth factor receptor signaling pathway | 12743035 |
| Hgene | ADAM17 | GO:0007220 | Notch receptor processing | 24226769 |
| Hgene | ADAM17 | GO:0032496 | response to lipopolysaccharide | 18383040 |
| Hgene | ADAM17 | GO:0033627 | cell adhesion mediated by integrin | 14970227 |
| Hgene | ADAM17 | GO:0043536 | positive regulation of blood vessel endothelial cell migration | 24813629 |
| Hgene | ADAM17 | GO:0045741 | positive regulation of epidermal growth factor-activated receptor activity | 18483258 |
| Hgene | ADAM17 | GO:0051088 | PMA-inducible membrane protein ectodomain proteolysis | 14625290|15691827|17010968 |
| Hgene | ADAM17 | GO:0071403 | cellular response to high density lipoprotein particle stimulus | 17786981 |
| Hgene | ADAM17 | GO:1905564 | positive regulation of vascular endothelial cell proliferation | 24813629 |
| Tgene | ITGB1BP1 | GO:0002043 | blood vessel endothelial cell proliferation involved in sprouting angiogenesis | 20616313 |
| Tgene | ITGB1BP1 | GO:0006469 | negative regulation of protein kinase activity | 20616313 |
| Tgene | ITGB1BP1 | GO:0007160 | cell-matrix adhesion | 9281591 |
| Tgene | ITGB1BP1 | GO:0007229 | integrin-mediated signaling pathway | 11919189|15703214 |
| Tgene | ITGB1BP1 | GO:0008284 | positive regulation of cell proliferation | 15703214 |
| Tgene | ITGB1BP1 | GO:0008285 | negative regulation of cell proliferation | 20616313 |
| Tgene | ITGB1BP1 | GO:0010595 | positive regulation of endothelial cell migration | 20616313 |
| Tgene | ITGB1BP1 | GO:0032091 | negative regulation of protein binding | 12473654 |
| Tgene | ITGB1BP1 | GO:0032148 | activation of protein kinase B activity | 20616313 |
| Tgene | ITGB1BP1 | GO:0035148 | tube formation | 20616313 |
| Tgene | ITGB1BP1 | GO:0035924 | cellular response to vascular endothelial growth factor stimulus | 20616313 |
| Tgene | ITGB1BP1 | GO:0043087 | regulation of GTPase activity | 11807099 |
| Tgene | ITGB1BP1 | GO:0044344 | cellular response to fibroblast growth factor stimulus | 20616313 |
| Tgene | ITGB1BP1 | GO:0045747 | positive regulation of Notch signaling pathway | 20616313 |
| Tgene | ITGB1BP1 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 15703214|20616313 |
| Tgene | ITGB1BP1 | GO:0051895 | negative regulation of focal adhesion assembly | 12473654 |
| Tgene | ITGB1BP1 | GO:0051897 | positive regulation of protein kinase B signaling | 20616313 |
| Tgene | ITGB1BP1 | GO:0070373 | negative regulation of ERK1 and ERK2 cascade | 20616313 |
| Tgene | ITGB1BP1 | GO:0072659 | protein localization to plasma membrane | 17916086 |
| Tgene | ITGB1BP1 | GO:0090051 | negative regulation of cell migration involved in sprouting angiogenesis | 20616313 |
| Tgene | ITGB1BP1 | GO:0090315 | negative regulation of protein targeting to membrane | 11807099 |
| Tgene | ITGB1BP1 | GO:0097746 | regulation of blood vessel diameter | 20616313 |
| Tgene | ITGB1BP1 | GO:1900025 | negative regulation of substrate adhesion-dependent cell spreading | 11807099 |
| Fusion gene breakpoints across ADAM17 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across ITGB1BP1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | HNSC | TCGA-CR-7389-01A | ADAM17 | chr2 | 9695638 | - | ITGB1BP1 | chr2 | 9558861 | - |
| ChimerDB4 | HNSC | TCGA-CR-7389 | ADAM17 | chr2 | 9695638 | - | ITGB1BP1 | chr2 | 9558861 | - |
| ChimerDB4 | STAD | TCGA-CD-5813 | ADAM17 | chr2 | 9675962 | - | ITGB1BP1 | chr2 | 9548334 | - |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000310823 | ADAM17 | chr2 | 9675962 | - | ENST00000360635 | ITGB1BP1 | chr2 | 9548334 | - | 4307 | 633 | 183 | 947 | 254 |
| ENST00000310823 | ADAM17 | chr2 | 9675962 | - | ENST00000238091 | ITGB1BP1 | chr2 | 9548334 | - | 1948 | 633 | 183 | 797 | 204 |
| ENST00000310823 | ADAM17 | chr2 | 9675962 | - | ENST00000355346 | ITGB1BP1 | chr2 | 9548334 | - | 2098 | 633 | 183 | 947 | 254 |
| ENST00000497134 | ADAM17 | chr2 | 9675962 | - | ENST00000360635 | ITGB1BP1 | chr2 | 9548334 | - | 4311 | 637 | 187 | 951 | 254 |
| ENST00000497134 | ADAM17 | chr2 | 9675962 | - | ENST00000238091 | ITGB1BP1 | chr2 | 9548334 | - | 1952 | 637 | 187 | 801 | 204 |
| ENST00000497134 | ADAM17 | chr2 | 9675962 | - | ENST00000355346 | ITGB1BP1 | chr2 | 9548334 | - | 2102 | 637 | 187 | 951 | 254 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000310823 | ENST00000360635 | ADAM17 | chr2 | 9675962 | - | ITGB1BP1 | chr2 | 9548334 | - | 0.00050711 | 0.9994929 |
| ENST00000310823 | ENST00000238091 | ADAM17 | chr2 | 9675962 | - | ITGB1BP1 | chr2 | 9548334 | - | 0.002639142 | 0.9973609 |
| ENST00000310823 | ENST00000355346 | ADAM17 | chr2 | 9675962 | - | ITGB1BP1 | chr2 | 9548334 | - | 0.002094149 | 0.99790585 |
| ENST00000497134 | ENST00000360635 | ADAM17 | chr2 | 9675962 | - | ITGB1BP1 | chr2 | 9548334 | - | 0.000507027 | 0.999493 |
| ENST00000497134 | ENST00000238091 | ADAM17 | chr2 | 9675962 | - | ITGB1BP1 | chr2 | 9548334 | - | 0.002278636 | 0.9977214 |
| ENST00000497134 | ENST00000355346 | ADAM17 | chr2 | 9675962 | - | ITGB1BP1 | chr2 | 9548334 | - | 0.001738299 | 0.99826175 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >1977_1977_1_ADAM17-ITGB1BP1_ADAM17_chr2_9675962_ENST00000310823_ITGB1BP1_chr2_9548334_ENST00000238091_length(amino acids)=204AA_BP=0 MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLLTFSALKRHFKLYLTSSTERF SQNFKVVVVDGKNESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQ -------------------------------------------------------------- >1977_1977_2_ADAM17-ITGB1BP1_ADAM17_chr2_9675962_ENST00000310823_ITGB1BP1_chr2_9548334_ENST00000355346_length(amino acids)=254AA_BP=0 MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLLTFSALKRHFKLYLTSSTERF SQNFKVVVVDGKNESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQ -------------------------------------------------------------- >1977_1977_3_ADAM17-ITGB1BP1_ADAM17_chr2_9675962_ENST00000310823_ITGB1BP1_chr2_9548334_ENST00000360635_length(amino acids)=254AA_BP=0 MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLLTFSALKRHFKLYLTSSTERF SQNFKVVVVDGKNESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQ -------------------------------------------------------------- >1977_1977_4_ADAM17-ITGB1BP1_ADAM17_chr2_9675962_ENST00000497134_ITGB1BP1_chr2_9548334_ENST00000238091_length(amino acids)=204AA_BP=0 MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLLTFSALKRHFKLYLTSSTERF SQNFKVVVVDGKNESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQ -------------------------------------------------------------- >1977_1977_5_ADAM17-ITGB1BP1_ADAM17_chr2_9675962_ENST00000497134_ITGB1BP1_chr2_9548334_ENST00000355346_length(amino acids)=254AA_BP=0 MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLLTFSALKRHFKLYLTSSTERF SQNFKVVVVDGKNESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQ -------------------------------------------------------------- >1977_1977_6_ADAM17-ITGB1BP1_ADAM17_chr2_9675962_ENST00000497134_ITGB1BP1_chr2_9548334_ENST00000360635_length(amino acids)=254AA_BP=0 MRQSLLFLTSVVPFVLAPRPPDDPGFGPHQRLEKLDSLLSDYDILSLSNIQQHSVRKRDLQTSTHVETLLTFSALKRHFKLYLTSSTERF SQNFKVVVVDGKNESEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQ -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:9695638/chr2:9558861) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| ADAM17 | ITGB1BP1 |
| FUNCTION: Cleaves the membrane-bound precursor of TNF-alpha to its mature soluble form (PubMed:9034191). Responsible for the proteolytical release of soluble JAM3 from endothelial cells surface (PubMed:20592283). Responsible for the proteolytic release of several other cell-surface proteins, including p75 TNF-receptor, interleukin 1 receptor type II, p55 TNF-receptor, transforming growth factor-alpha, L-selectin, growth hormone receptor, MUC1 and the amyloid precursor protein (PubMed:12441351). Acts as an activator of Notch pathway by mediating cleavage of Notch, generating the membrane-associated intermediate fragment called Notch extracellular truncation (NEXT) (PubMed:24226769). Plays a role in the proteolytic processing of ACE2 (PubMed:24227843). Plays a role in hemostasis through shedding of GP1BA, the platelet glycoprotein Ib alpha chain (By similarity). Mediates the proteolytic cleavage of LAG3, leading to release the secreted form of LAG3 (By similarity). Mediates the proteolytic cleavage of IL6R, leading to the release of secreted form of IL6R (PubMed:26876177, PubMed:28060820). {ECO:0000250|UniProtKB:Q9Z0F8, ECO:0000269|PubMed:12441351, ECO:0000269|PubMed:20592283, ECO:0000269|PubMed:24226769, ECO:0000269|PubMed:24227843, ECO:0000269|PubMed:26876177, ECO:0000269|PubMed:28060820, ECO:0000269|PubMed:9034191}. | FUNCTION: Key regulator of the integrin-mediated cell-matrix interaction signaling by binding to the ITGB1 cytoplasmic tail and preventing the activation of integrin alpha-5/beta-1 (heterodimer of ITGA5 and ITGB1) by talin or FERMT1. Plays a role in cell proliferation, differentiation, spreading, adhesion and migration in the context of mineralization and bone development and angiogenesis. Stimulates cellular proliferation in a fibronectin-dependent manner. Involved in the regulation of beta-1 integrin-containing focal adhesion (FA) site dynamics by controlling its assembly rate during cell adhesion; inhibits beta-1 integrin clustering within FA by directly competing with talin TLN1, and hence stimulates osteoblast spreading and migration in a fibronectin- and/or collagen-dependent manner. Acts as a guanine nucleotide dissociation inhibitor (GDI) by regulating Rho family GTPases during integrin-mediated cell matrix adhesion; reduces the level of active GTP-bound form of both CDC42 and RAC1 GTPases upon cell adhesion to fibronectin. Stimulates the release of active CDC42 from the membranes to maintain it in an inactive cytoplasmic pool. Participates in the translocation of the Rho-associated protein kinase ROCK1 to membrane ruffles at cell leading edges of the cell membrane, leading to an increase of myoblast cell migration on laminin. Plays a role in bone mineralization at a late stage of osteoblast differentiation; modulates the dynamic formation of focal adhesions into fibrillar adhesions, which are adhesive structures responsible for fibronectin deposition and fibrillogenesis. Plays a role in blood vessel development; acts as a negative regulator of angiogenesis by attenuating endothelial cell proliferation and migration, lumen formation and sprouting angiogenesis by promoting AKT phosphorylation and inhibiting ERK1/2 phosphorylation through activation of the Notch signaling pathway. Promotes transcriptional activity of the MYC promoter. {ECO:0000269|PubMed:11741838, ECO:0000269|PubMed:11807099, ECO:0000269|PubMed:11919189, ECO:0000269|PubMed:12473654, ECO:0000269|PubMed:15703214, ECO:0000269|PubMed:17916086, ECO:0000269|PubMed:20616313, ECO:0000269|PubMed:21768292, ECO:0000269|Ref.19}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ADAM17 | chr2:9675962 | chr2:9548334 | ENST00000310823 | - | 4 | 19 | 96_99 | 150.0 | 825.0 | Compositional bias | Note=Poly-Val |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | ADAM17 | chr2:9675962 | chr2:9548334 | ENST00000310823 | - | 4 | 19 | 564_602 | 150.0 | 825.0 | Compositional bias | Note=Cys-rich |
| Hgene | ADAM17 | chr2:9675962 | chr2:9548334 | ENST00000310823 | - | 4 | 19 | 223_474 | 150.0 | 825.0 | Domain | Peptidase M12B |
| Hgene | ADAM17 | chr2:9675962 | chr2:9548334 | ENST00000310823 | - | 4 | 19 | 475_563 | 150.0 | 825.0 | Domain | Disintegrin |
| Hgene | ADAM17 | chr2:9675962 | chr2:9548334 | ENST00000310823 | - | 4 | 19 | 182_189 | 150.0 | 825.0 | Motif | Cysteine switch |
| Hgene | ADAM17 | chr2:9675962 | chr2:9548334 | ENST00000310823 | - | 4 | 19 | 731_738 | 150.0 | 825.0 | Motif | SH3-binding |
| Hgene | ADAM17 | chr2:9675962 | chr2:9548334 | ENST00000310823 | - | 4 | 19 | 741_748 | 150.0 | 825.0 | Motif | SH3-binding |
| Hgene | ADAM17 | chr2:9675962 | chr2:9548334 | ENST00000310823 | - | 4 | 19 | 603_671 | 150.0 | 825.0 | Region | Note=Crambin-like |
| Hgene | ADAM17 | chr2:9675962 | chr2:9548334 | ENST00000310823 | - | 4 | 19 | 215_671 | 150.0 | 825.0 | Topological domain | Extracellular |
| Hgene | ADAM17 | chr2:9675962 | chr2:9548334 | ENST00000310823 | - | 4 | 19 | 693_824 | 150.0 | 825.0 | Topological domain | Cytoplasmic |
| Hgene | ADAM17 | chr2:9675962 | chr2:9548334 | ENST00000310823 | - | 4 | 19 | 672_692 | 150.0 | 825.0 | Transmembrane | Helical |
| Tgene | ITGB1BP1 | chr2:9675962 | chr2:9548334 | ENST00000238091 | 3 | 6 | 10_57 | 96.0 | 151.0 | Compositional bias | Note=Ser/Thr-rich | |
| Tgene | ITGB1BP1 | chr2:9675962 | chr2:9548334 | ENST00000355346 | 3 | 7 | 10_57 | 96.0 | 201.0 | Compositional bias | Note=Ser/Thr-rich | |
| Tgene | ITGB1BP1 | chr2:9675962 | chr2:9548334 | ENST00000360635 | 4 | 8 | 10_57 | 96.0 | 201.0 | Compositional bias | Note=Ser/Thr-rich | |
| Tgene | ITGB1BP1 | chr2:9675962 | chr2:9548334 | ENST00000488451 | 4 | 7 | 10_57 | 96.0 | 151.0 | Compositional bias | Note=Ser/Thr-rich | |
| Tgene | ITGB1BP1 | chr2:9675962 | chr2:9548334 | ENST00000238091 | 3 | 6 | 58_200 | 96.0 | 151.0 | Domain | Note=PID | |
| Tgene | ITGB1BP1 | chr2:9675962 | chr2:9548334 | ENST00000355346 | 3 | 7 | 58_200 | 96.0 | 201.0 | Domain | Note=PID | |
| Tgene | ITGB1BP1 | chr2:9675962 | chr2:9548334 | ENST00000360635 | 4 | 8 | 58_200 | 96.0 | 201.0 | Domain | Note=PID | |
| Tgene | ITGB1BP1 | chr2:9675962 | chr2:9548334 | ENST00000488451 | 4 | 7 | 58_200 | 96.0 | 151.0 | Domain | Note=PID |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| ADAM17 | |
| ITGB1BP1 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to ADAM17-ITGB1BP1 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to ADAM17-ITGB1BP1 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies