UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Fusion Protein:CYLD-HAGH |
Fusion Protein Summary |
Fusion gene summary |
Fusion partner gene information | Fusion gene name: CYLD-HAGH | FusionPDB ID: 20992 | FusionGDB2.0 ID: 20992 | Hgene | Tgene | Gene symbol | CYLD | HAGH | Gene ID | 1540 | 3029 |
Gene name | CYLD lysine 63 deubiquitinase | hydroxyacylglutathione hydrolase | |
Synonyms | BRSS|CDMT|CYLD1|CYLDI|EAC|MFT|MFT1|SBS|TEM|USPL2 | GLO2|GLX2|GLXII|HAGH1 | |
Cytomap | 16q12.1 | 16p13.3 | |
Type of gene | protein-coding | protein-coding | |
Description | ubiquitin carboxyl-terminal hydrolase CYLDcylindromatosis (turban tumor syndrome)deubiquitinating enzyme CYLDprobable ubiquitin carboxyl-terminal hydrolase CYLDubiquitin specific peptidase like 2ubiquitin thioesterase CYLDubiquitin thiolesterase CYL | hydroxyacylglutathione hydrolase, mitochondrialglyoxalase IIhydroxyacylglutathione hydroxylase | |
Modification date | 20200329 | 20200313 | |
UniProtAcc | Q9NQC7 | Q6PII5 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000311559, ENST00000398568, ENST00000427738, ENST00000540145, ENST00000564326, ENST00000566206, ENST00000568704, ENST00000569418, | ENST00000566709, ENST00000567398, ENST00000397353, ENST00000397356, ENST00000455446, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 6 X 4 X 4=96 | 4 X 2 X 4=32 |
# samples | 6 | 4 | |
** MAII score | log2(6/96*10)=-0.678071905112638 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(4/32*10)=0.321928094887362 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: CYLD [Title/Abstract] AND HAGH [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CYLD(50788335)-HAGH(1859834), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | CYLD-HAGH seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CYLD-HAGH seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CYLD-HAGH seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CYLD-HAGH seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CYLD-HAGH seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. CYLD-HAGH seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. CYLD-HAGH seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | CYLD | GO:0010803 | regulation of tumor necrosis factor-mediated signaling pathway | 26997266|27458237|27591049 |
Hgene | CYLD | GO:0016579 | protein deubiquitination | 29291351 |
Hgene | CYLD | GO:0032088 | negative regulation of NF-kappaB transcription factor activity | 18313383 |
Hgene | CYLD | GO:0045087 | innate immune response | 26997266 |
Hgene | CYLD | GO:0046329 | negative regulation of JNK cascade | 29291351 |
Hgene | CYLD | GO:0050727 | regulation of inflammatory response | 27591049 |
Hgene | CYLD | GO:0060544 | regulation of necroptotic process | 27458237 |
Hgene | CYLD | GO:0070536 | protein K63-linked deubiquitination | 18313383|18636086|26997266|27458237|27591049|29291351 |
Hgene | CYLD | GO:1901223 | negative regulation of NIK/NF-kappaB signaling | 18313383 |
Hgene | CYLD | GO:1903753 | negative regulation of p38MAPK cascade | 29291351 |
Hgene | CYLD | GO:1990108 | protein linear deubiquitination | 26997266|27458237|27591049 |
Tgene | HAGH | GO:0006750 | glutathione biosynthetic process | 8550579 |
Fusion gene breakpoints across CYLD (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across HAGH (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | GBM | TCGA-14-0736-02A | CYLD | chr16 | 50788335 | + | HAGH | chr16 | 1859834 | - |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000569418 | CYLD | chr16 | 50788335 | + | ENST00000455446 | HAGH | chr16 | 1859834 | - | 1782 | 1191 | 278 | 1300 | 340 |
ENST00000540145 | CYLD | chr16 | 50788335 | + | ENST00000455446 | HAGH | chr16 | 1859834 | - | 1919 | 1328 | 415 | 1437 | 340 |
ENST00000311559 | CYLD | chr16 | 50788335 | + | ENST00000455446 | HAGH | chr16 | 1859834 | - | 1895 | 1304 | 391 | 1413 | 340 |
ENST00000564326 | CYLD | chr16 | 50788335 | + | ENST00000455446 | HAGH | chr16 | 1859834 | - | 1698 | 1107 | 194 | 1216 | 340 |
ENST00000566206 | CYLD | chr16 | 50788335 | + | ENST00000455446 | HAGH | chr16 | 1859834 | - | 1754 | 1163 | 250 | 1272 | 340 |
ENST00000398568 | CYLD | chr16 | 50788335 | + | ENST00000455446 | HAGH | chr16 | 1859834 | - | 1804 | 1213 | 300 | 1322 | 340 |
ENST00000427738 | CYLD | chr16 | 50788335 | + | ENST00000455446 | HAGH | chr16 | 1859834 | - | 1709 | 1118 | 205 | 1227 | 340 |
ENST00000568704 | CYLD | chr16 | 50788335 | + | ENST00000455446 | HAGH | chr16 | 1859834 | - | 1654 | 1063 | 150 | 1172 | 340 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000569418 | ENST00000455446 | CYLD | chr16 | 50788335 | + | HAGH | chr16 | 1859834 | - | 0.000356486 | 0.99964356 |
ENST00000540145 | ENST00000455446 | CYLD | chr16 | 50788335 | + | HAGH | chr16 | 1859834 | - | 0.000215028 | 0.999785 |
ENST00000311559 | ENST00000455446 | CYLD | chr16 | 50788335 | + | HAGH | chr16 | 1859834 | - | 0.000212641 | 0.9997874 |
ENST00000564326 | ENST00000455446 | CYLD | chr16 | 50788335 | + | HAGH | chr16 | 1859834 | - | 0.000403401 | 0.99959666 |
ENST00000566206 | ENST00000455446 | CYLD | chr16 | 50788335 | + | HAGH | chr16 | 1859834 | - | 0.000362295 | 0.9996377 |
ENST00000398568 | ENST00000455446 | CYLD | chr16 | 50788335 | + | HAGH | chr16 | 1859834 | - | 0.000342777 | 0.9996573 |
ENST00000427738 | ENST00000455446 | CYLD | chr16 | 50788335 | + | HAGH | chr16 | 1859834 | - | 0.000357053 | 0.99964297 |
ENST00000568704 | ENST00000455446 | CYLD | chr16 | 50788335 | + | HAGH | chr16 | 1859834 | - | 0.000379031 | 0.9996209 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >20992_20992_1_CYLD-HAGH_CYLD_chr16_50788335_ENST00000311559_HAGH_chr16_1859834_ENST00000455446_length(amino acids)=340AA_BP=304 MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRIPSAKGKKNQIGLKILEQPHAVLFVDEKDVV EINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPGDTMQVELPPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMD -------------------------------------------------------------- >20992_20992_2_CYLD-HAGH_CYLD_chr16_50788335_ENST00000398568_HAGH_chr16_1859834_ENST00000455446_length(amino acids)=340AA_BP=304 MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRIPSAKGKKNQIGLKILEQPHAVLFVDEKDVV EINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPGDTMQVELPPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMD -------------------------------------------------------------- >20992_20992_3_CYLD-HAGH_CYLD_chr16_50788335_ENST00000427738_HAGH_chr16_1859834_ENST00000455446_length(amino acids)=340AA_BP=304 MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRIPSAKGKKNQIGLKILEQPHAVLFVDEKDVV EINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPGDTMQVELPPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMD -------------------------------------------------------------- >20992_20992_4_CYLD-HAGH_CYLD_chr16_50788335_ENST00000540145_HAGH_chr16_1859834_ENST00000455446_length(amino acids)=340AA_BP=304 MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRIPSAKGKKNQIGLKILEQPHAVLFVDEKDVV EINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPGDTMQVELPPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMD -------------------------------------------------------------- >20992_20992_5_CYLD-HAGH_CYLD_chr16_50788335_ENST00000564326_HAGH_chr16_1859834_ENST00000455446_length(amino acids)=340AA_BP=304 MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRIPSAKGKKNQIGLKILEQPHAVLFVDEKDVV EINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPGDTMQVELPPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMD -------------------------------------------------------------- >20992_20992_6_CYLD-HAGH_CYLD_chr16_50788335_ENST00000566206_HAGH_chr16_1859834_ENST00000455446_length(amino acids)=340AA_BP=304 MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRIPSAKGKKNQIGLKILEQPHAVLFVDEKDVV EINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPGDTMQVELPPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMD -------------------------------------------------------------- >20992_20992_7_CYLD-HAGH_CYLD_chr16_50788335_ENST00000568704_HAGH_chr16_1859834_ENST00000455446_length(amino acids)=340AA_BP=304 MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRIPSAKGKKNQIGLKILEQPHAVLFVDEKDVV EINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPGDTMQVELPPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMD -------------------------------------------------------------- >20992_20992_8_CYLD-HAGH_CYLD_chr16_50788335_ENST00000569418_HAGH_chr16_1859834_ENST00000455446_length(amino acids)=340AA_BP=304 MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRIPSAKGKKNQIGLKILEQPHAVLFVDEKDVV EINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPGDTMQVELPPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMD -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr16:50788335/chr16:1859834) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
CYLD | HAGH |
FUNCTION: Deubiquitinase that specifically cleaves 'Lys-63'- and linear 'Met-1'-linked polyubiquitin chains and is involved in NF-kappa-B activation and TNF-alpha-induced necroptosis (PubMed:18636086, PubMed:26670046, PubMed:27458237, PubMed:26997266, PubMed:27591049, PubMed:29291351, PubMed:18313383). Plays an important role in the regulation of pathways leading to NF-kappa-B activation (PubMed:12917689, PubMed:12917691). Contributes to the regulation of cell survival, proliferation and differentiation via its effects on NF-kappa-B activation (PubMed:12917690). Negative regulator of Wnt signaling (PubMed:20227366). Inhibits HDAC6 and thereby promotes acetylation of alpha-tubulin and stabilization of microtubules (PubMed:19893491). Plays a role in the regulation of microtubule dynamics, and thereby contributes to the regulation of cell proliferation, cell polarization, cell migration, and angiogenesis (PubMed:18222923, PubMed:20194890). Required for normal cell cycle progress and normal cytokinesis (PubMed:17495026, PubMed:19893491). Inhibits nuclear translocation of NF-kappa-B (PubMed:18636086). Plays a role in the regulation of inflammation and the innate immune response, via its effects on NF-kappa-B activation (PubMed:18636086). Dispensable for the maturation of intrathymic natural killer cells, but required for the continued survival of immature natural killer cells (By similarity). Negatively regulates TNFRSF11A signaling and osteoclastogenesis (By similarity). Involved in the regulation of ciliogenesis, allowing ciliary basal bodies to migrate and dock to the plasma membrane; this process does not depend on NF-kappa-B activation (By similarity). Ability to remove linear ('Met-1'-linked) polyubiquitin chains regulates innate immunity and TNF-alpha-induced necroptosis: recruited to the LUBAC complex via interaction with SPATA2 and restricts linear polyubiquitin formation on target proteins (PubMed:26997266, PubMed:26670046, PubMed:27458237, PubMed:27591049). Regulates innate immunity by restricting linear polyubiquitin formation on RIPK2 in response to NOD2 stimulation (PubMed:26997266). Involved in TNF-alpha-induced necroptosis by removing linear ('Met-1'-linked) polyubiquitin chains from RIPK1, thereby regulating the kinase activity of RIPK1 (By similarity). Removes 'Lys-63' linked polyubiquitin chain of MAP3K7, which inhibits phosphorylation and blocks downstream activation of the JNK-p38 kinase cascades (PubMed:29291351). {ECO:0000250|UniProtKB:Q80TQ2, ECO:0000269|PubMed:12917689, ECO:0000269|PubMed:12917690, ECO:0000269|PubMed:12917691, ECO:0000269|PubMed:17495026, ECO:0000269|PubMed:18222923, ECO:0000269|PubMed:18313383, ECO:0000269|PubMed:18636086, ECO:0000269|PubMed:19893491, ECO:0000269|PubMed:20194890, ECO:0000269|PubMed:20227366, ECO:0000269|PubMed:26670046, ECO:0000269|PubMed:26997266, ECO:0000269|PubMed:27458237, ECO:0000269|PubMed:27591049, ECO:0000269|PubMed:29291351}. | FUNCTION: Hydrolase acting on ester bonds. {ECO:0000305}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000311559 | + | 6 | 20 | 153_198 | 304.3333333333333 | 957.0 | Domain | CAP-Gly 1 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000311559 | + | 6 | 20 | 253_286 | 304.3333333333333 | 957.0 | Domain | CAP-Gly 2 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000398568 | + | 5 | 18 | 153_198 | 304.3333333333333 | 954.0 | Domain | CAP-Gly 1 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000398568 | + | 5 | 18 | 253_286 | 304.3333333333333 | 954.0 | Domain | CAP-Gly 2 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000427738 | + | 4 | 18 | 153_198 | 304.3333333333333 | 957.0 | Domain | CAP-Gly 1 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000427738 | + | 4 | 18 | 253_286 | 304.3333333333333 | 957.0 | Domain | CAP-Gly 2 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000564326 | + | 4 | 17 | 153_198 | 304.3333333333333 | 954.0 | Domain | CAP-Gly 1 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000564326 | + | 4 | 17 | 253_286 | 304.3333333333333 | 954.0 | Domain | CAP-Gly 2 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000569418 | + | 5 | 18 | 153_198 | 304.3333333333333 | 954.0 | Domain | CAP-Gly 1 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000569418 | + | 5 | 18 | 253_286 | 304.3333333333333 | 954.0 | Domain | CAP-Gly 2 |
Tgene | HAGH | chr16:50788335 | chr16:1859834 | ENST00000397353 | 7 | 10 | 221_223 | 201.0 | 261.0 | Region | Substrate binding | |
Tgene | HAGH | chr16:50788335 | chr16:1859834 | ENST00000397353 | 7 | 10 | 297_300 | 201.0 | 261.0 | Region | Substrate binding | |
Tgene | HAGH | chr16:50788335 | chr16:1859834 | ENST00000397356 | 6 | 9 | 297_300 | 249.0 | 309.0 | Region | Substrate binding |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000311559 | + | 6 | 20 | 492_535 | 304.3333333333333 | 957.0 | Domain | CAP-Gly 3 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000311559 | + | 6 | 20 | 592_950 | 304.3333333333333 | 957.0 | Domain | Note=USP |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000398568 | + | 5 | 18 | 492_535 | 304.3333333333333 | 954.0 | Domain | CAP-Gly 3 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000398568 | + | 5 | 18 | 592_950 | 304.3333333333333 | 954.0 | Domain | Note=USP |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000427738 | + | 4 | 18 | 492_535 | 304.3333333333333 | 957.0 | Domain | CAP-Gly 3 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000427738 | + | 4 | 18 | 592_950 | 304.3333333333333 | 957.0 | Domain | Note=USP |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000564326 | + | 4 | 17 | 492_535 | 304.3333333333333 | 954.0 | Domain | CAP-Gly 3 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000564326 | + | 4 | 17 | 592_950 | 304.3333333333333 | 954.0 | Domain | Note=USP |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000569418 | + | 5 | 18 | 492_535 | 304.3333333333333 | 954.0 | Domain | CAP-Gly 3 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000569418 | + | 5 | 18 | 592_950 | 304.3333333333333 | 954.0 | Domain | Note=USP |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000311559 | + | 6 | 20 | 781_833 | 304.3333333333333 | 957.0 | Region | B-box |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000398568 | + | 5 | 18 | 781_833 | 304.3333333333333 | 954.0 | Region | B-box |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000427738 | + | 4 | 18 | 781_833 | 304.3333333333333 | 957.0 | Region | B-box |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000564326 | + | 4 | 17 | 781_833 | 304.3333333333333 | 954.0 | Region | B-box |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000569418 | + | 5 | 18 | 781_833 | 304.3333333333333 | 954.0 | Region | B-box |
Tgene | HAGH | chr16:50788335 | chr16:1859834 | ENST00000397353 | 7 | 10 | 191_193 | 201.0 | 261.0 | Region | Substrate binding | |
Tgene | HAGH | chr16:50788335 | chr16:1859834 | ENST00000397356 | 6 | 9 | 191_193 | 249.0 | 309.0 | Region | Substrate binding | |
Tgene | HAGH | chr16:50788335 | chr16:1859834 | ENST00000397356 | 6 | 9 | 221_223 | 249.0 | 309.0 | Region | Substrate binding |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
Gene | STRING network |
CYLD | |
HAGH |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000311559 | + | 6 | 20 | 470_554 | 304.3333333333333 | 957.0 | IKBKG/NEMO |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000398568 | + | 5 | 18 | 470_554 | 304.3333333333333 | 954.0 | IKBKG/NEMO |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000427738 | + | 4 | 18 | 470_554 | 304.3333333333333 | 957.0 | IKBKG/NEMO |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000564326 | + | 4 | 17 | 470_554 | 304.3333333333333 | 954.0 | IKBKG/NEMO |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000569418 | + | 5 | 18 | 470_554 | 304.3333333333333 | 954.0 | IKBKG/NEMO |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000311559 | + | 6 | 20 | 394_469 | 304.3333333333333 | 957.0 | TRAF2 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000398568 | + | 5 | 18 | 394_469 | 304.3333333333333 | 954.0 | TRAF2 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000427738 | + | 4 | 18 | 394_469 | 304.3333333333333 | 957.0 | TRAF2 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000564326 | + | 4 | 17 | 394_469 | 304.3333333333333 | 954.0 | TRAF2 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000569418 | + | 5 | 18 | 394_469 | 304.3333333333333 | 954.0 | TRAF2 |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000311559 | + | 6 | 20 | 106_593 | 304.3333333333333 | 957.0 | TRIP |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000398568 | + | 5 | 18 | 106_593 | 304.3333333333333 | 954.0 | TRIP |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000427738 | + | 4 | 18 | 106_593 | 304.3333333333333 | 957.0 | TRIP |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000564326 | + | 4 | 17 | 106_593 | 304.3333333333333 | 954.0 | TRIP |
Hgene | CYLD | chr16:50788335 | chr16:1859834 | ENST00000569418 | + | 5 | 18 | 106_593 | 304.3333333333333 | 954.0 | TRIP |
Top |
Related Drugs to CYLD-HAGH |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to CYLD-HAGH |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |