| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:CYP4F12-MYO9B |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: CYP4F12-MYO9B | FusionPDB ID: 21092 | FusionGDB2.0 ID: 21092 | Hgene | Tgene | Gene symbol | CYP4F12 | MYO9B | Gene ID | 66002 | 4650 |
| Gene name | cytochrome P450 family 4 subfamily F member 12 | myosin IXB | |
| Synonyms | CYPIVF12|F22329_1 | CELIAC4|MYR5 | |
| Cytomap | 19p13.12 | 19p13.11 | |
| Type of gene | protein-coding | protein-coding | |
| Description | cytochrome P450 4F12cytochrome P450, family 4, subfamily F, polypeptide 12cytochrome P450, subfamily IVF, polypeptide 12 | unconventional myosin-IXbmyosin-IXbunconventional myosin-9b | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q9HCS2 | Q13459 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000324632, ENST00000550308, | ENST00000593411, ENST00000397274, ENST00000594824, ENST00000595618, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 3 X 3 X 3=27 | 15 X 18 X 8=2160 |
| # samples | 3 | 18 | |
| ** MAII score | log2(3/27*10)=0.15200309344505 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | log2(18/2160*10)=-3.58496250072116 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: CYP4F12 [Title/Abstract] AND MYO9B [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | CYP4F12(15807880)-MYO9B(17312948), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | CYP4F12-MYO9B seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. CYP4F12-MYO9B seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. CYP4F12-MYO9B seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. CYP4F12-MYO9B seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | MYO9B | GO:0030048 | actin filament-based movement | 9490638 |
| Tgene | MYO9B | GO:0032011 | ARF protein signal transduction | 15644318 |
| Tgene | MYO9B | GO:0035385 | Roundabout signaling pathway | 26529257 |
| Fusion gene breakpoints across CYP4F12 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across MYO9B (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BLCA | TCGA-XF-A9SV-01A | CYP4F12 | chr19 | 15807880 | + | MYO9B | chr19 | 17312948 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000324632 | CYP4F12 | chr19 | 15807880 | + | ENST00000595618 | MYO9B | chr19 | 17312948 | + | 4323 | 1524 | 40 | 1452 | 470 |
| ENST00000324632 | CYP4F12 | chr19 | 15807880 | + | ENST00000594824 | MYO9B | chr19 | 17312948 | + | 4300 | 1524 | 1544 | 3325 | 593 |
| ENST00000324632 | CYP4F12 | chr19 | 15807880 | + | ENST00000397274 | MYO9B | chr19 | 17312948 | + | 4322 | 1524 | 40 | 1452 | 470 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000324632 | ENST00000595618 | CYP4F12 | chr19 | 15807880 | + | MYO9B | chr19 | 17312948 | + | 0.10373923 | 0.89626074 |
| ENST00000324632 | ENST00000594824 | CYP4F12 | chr19 | 15807880 | + | MYO9B | chr19 | 17312948 | + | 0.022096284 | 0.9779037 |
| ENST00000324632 | ENST00000397274 | CYP4F12 | chr19 | 15807880 | + | MYO9B | chr19 | 17312948 | + | 0.103911996 | 0.896088 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >21092_21092_1_CYP4F12-MYO9B_CYP4F12_chr19_15807880_ENST00000324632_MYO9B_chr19_17312948_ENST00000397274_length(amino acids)=470AA_BP= MPCRMSLLSLPWLGLRPVATSPWLLLLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWFWGHLGLITPTEEGLKNSTQMSATYSQ GFTIWLGPIIPFIVLCHPDTIRSITNASAAIAPKDNLFIRFLKPWLGEGILLSGGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLD KWQHLASEGSSCLDMFEHISLMTLDSLQKCIFSFDSHCQERPSEYIATILELSALVEKRSQHILQHMDFLYYLSHDGRRFHRACRLVHDF TDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDVLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQ EVQELLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITCLIDIIGVHHNPTVWPDPEVYDPFRFD -------------------------------------------------------------- >21092_21092_2_CYP4F12-MYO9B_CYP4F12_chr19_15807880_ENST00000324632_MYO9B_chr19_17312948_ENST00000594824_length(amino acids)=593AA_BP= MMENYQIVVSNLATERGQKDTNLVLNLFQSLLDEFTRGYTKNDFEPVKQSKAQKKKRKQERAVQEHNGHVFASYQVSIPQSCEQCLSYIW LMDKALLCSVCKMTCHKKCVHKIQSHCSYTYGRKGEPGVEPGHFGVCVDSLTSDKASVPIVLEKLLEHVEMHGLYTEGLYRKSGAANRTR ELRQALQTDPAAVKLENFPIHAITGVLKQWLRELPEPLMTFAQYGDFLRAVELPEKQEQLAAIYAVLEHLPEANHNSLERLIFHLVKVAL LEDVNRMSPGALAIIFAPCLLRCPDNSDPLTSMKDVLKITTCVEMLIKEQMRKYKVKMEEISQLEAAESIAFRRLSLLRQNAPWPLKLGF SSPYEGVLNKSPKTRDIQEEELEVLLEEEAAGGDEDREKEILIERIQSIKEEKQDITYRLPELDPRGSDEENLDSETSASTESLLEERAG RGASEGPPAPALPCPGAPTPSPLPTVAAPPRRRPSSFVTVRVKTPRRTPIMPTANIKLPPGLPSHLPRWAPGAREAAAPVRRREPPARRP -------------------------------------------------------------- >21092_21092_3_CYP4F12-MYO9B_CYP4F12_chr19_15807880_ENST00000324632_MYO9B_chr19_17312948_ENST00000595618_length(amino acids)=470AA_BP= MPCRMSLLSLPWLGLRPVATSPWLLLLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWFWGHLGLITPTEEGLKNSTQMSATYSQ GFTIWLGPIIPFIVLCHPDTIRSITNASAAIAPKDNLFIRFLKPWLGEGILLSGGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLD KWQHLASEGSSCLDMFEHISLMTLDSLQKCIFSFDSHCQERPSEYIATILELSALVEKRSQHILQHMDFLYYLSHDGRRFHRACRLVHDF TDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDVLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQ EVQELLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITCLIDIIGVHHNPTVWPDPEVYDPFRFD -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:15807880/chr19:17312948) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| CYP4F12 | MYO9B |
| FUNCTION: A cytochrome P450 monooxygenase involved in the metabolism of endogenous polyunsaturated fatty acids (PUFAs). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase). Catalyzes the hydroxylation of carbon hydrogen bonds, with preference for omega-2 position. Metabolizes (5Z,8Z,11Z,14Z)-eicosatetraenoic acid (arachidonate) toward 18-hydroxy arachidonate (PubMed:11162607). Catalyzes the epoxidation of double bonds of PUFAs such as docosapentaenoic and docosahexaenoic acids (PubMed:16112640). Has low omega-hydroxylase activity toward leukotriene B4 and arachidonate (PubMed:11162645). Involved in the metabolism of xenobiotics. Catalyzes the hydroxylation of the antihistamine drug ebastine (PubMed:11162645). {ECO:0000269|PubMed:11162607, ECO:0000269|PubMed:11162645, ECO:0000269|PubMed:16112640}. | FUNCTION: Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Binds actin with high affinity both in the absence and presence of ATP and its mechanochemical activity is inhibited by calcium ions (PubMed:9490638). Also acts as a GTPase activator for RHOA (PubMed:9490638, PubMed:26529257). Plays a role in the regulation of cell migration via its role as RHOA GTPase activator. This is regulated by its interaction with the SLIT2 receptor ROBO1; interaction with ROBO1 impairs interaction with RHOA and subsequent activation of RHOA GTPase activity, and thereby leads to increased levels of active, GTP-bound RHOA (PubMed:26529257). {ECO:0000269|PubMed:26529257, ECO:0000269|PubMed:9490638}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000397274 | 0 | 39 | 1046_1071 | 0 | 2189.0 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000397274 | 0 | 39 | 1880_1901 | 0 | 2189.0 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000397274 | 0 | 39 | 1959_1989 | 0 | 2189.0 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000595618 | 0 | 40 | 1046_1071 | 0 | 2458.6666666666665 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000595618 | 0 | 40 | 1880_1901 | 0 | 2458.6666666666665 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000595618 | 0 | 40 | 1959_1989 | 0 | 2458.6666666666665 | Coiled coil | Ontology_term=ECO:0000255 | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000397274 | 0 | 39 | 1001_1023 | 0 | 2189.0 | Domain | IQ 3 | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000397274 | 0 | 39 | 1024_1053 | 0 | 2189.0 | Domain | IQ 4 | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000397274 | 0 | 39 | 146_953 | 0 | 2189.0 | Domain | Myosin motor | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000397274 | 0 | 39 | 15_114 | 0 | 2189.0 | Domain | Ras-associating | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000397274 | 0 | 39 | 1703_1888 | 0 | 2189.0 | Domain | Rho-GAP | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000397274 | 0 | 39 | 957_977 | 0 | 2189.0 | Domain | IQ 1 | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000397274 | 0 | 39 | 979_1000 | 0 | 2189.0 | Domain | IQ 2 | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000595618 | 0 | 40 | 1001_1023 | 0 | 2458.6666666666665 | Domain | IQ 3 | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000595618 | 0 | 40 | 1024_1053 | 0 | 2458.6666666666665 | Domain | IQ 4 | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000595618 | 0 | 40 | 146_953 | 0 | 2458.6666666666665 | Domain | Myosin motor | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000595618 | 0 | 40 | 15_114 | 0 | 2458.6666666666665 | Domain | Ras-associating | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000595618 | 0 | 40 | 1703_1888 | 0 | 2458.6666666666665 | Domain | Rho-GAP | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000595618 | 0 | 40 | 957_977 | 0 | 2458.6666666666665 | Domain | IQ 1 | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000595618 | 0 | 40 | 979_1000 | 0 | 2458.6666666666665 | Domain | IQ 2 | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000397274 | 0 | 39 | 239_246 | 0 | 2189.0 | Nucleotide binding | ATP | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000595618 | 0 | 40 | 239_246 | 0 | 2458.6666666666665 | Nucleotide binding | ATP | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000397274 | 0 | 39 | 1045_2157 | 0 | 2189.0 | Region | Tail | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000397274 | 0 | 39 | 844_855 | 0 | 2189.0 | Region | Actin-binding | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000397274 | 0 | 39 | 940_1044 | 0 | 2189.0 | Region | Neck or regulatory domain | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000595618 | 0 | 40 | 1045_2157 | 0 | 2458.6666666666665 | Region | Tail | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000595618 | 0 | 40 | 844_855 | 0 | 2458.6666666666665 | Region | Actin-binding | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000595618 | 0 | 40 | 940_1044 | 0 | 2458.6666666666665 | Region | Neck or regulatory domain | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000397274 | 0 | 39 | 1632_1681 | 0 | 2189.0 | Zinc finger | Phorbol-ester/DAG-type | |
| Tgene | MYO9B | chr19:15807880 | chr19:17312948 | ENST00000595618 | 0 | 40 | 1632_1681 | 0 | 2458.6666666666665 | Zinc finger | Phorbol-ester/DAG-type |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | CYP4F12 | chr19:15807880 | chr19:17312948 | ENST00000324632 | + | 1 | 12 | 19_39 | 0 | 525.0 | Transmembrane | Helical |
| Hgene | CYP4F12 | chr19:15807880 | chr19:17312948 | ENST00000324632 | + | 1 | 12 | 87_107 | 0 | 525.0 | Transmembrane | Helical |
| Hgene | CYP4F12 | chr19:15807880 | chr19:17312948 | ENST00000550308 | + | 1 | 13 | 19_39 | 0 | 525.0 | Transmembrane | Helical |
| Hgene | CYP4F12 | chr19:15807880 | chr19:17312948 | ENST00000550308 | + | 1 | 13 | 87_107 | 0 | 525.0 | Transmembrane | Helical |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| CYP4F12 | |
| MYO9B |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to CYP4F12-MYO9B |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to CYP4F12-MYO9B |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies