| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:EFR3B-NCOA1 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: EFR3B-NCOA1 | FusionPDB ID: 25408 | FusionGDB2.0 ID: 25408 | Hgene | Tgene | Gene symbol | EFR3B | NCOA1 | Gene ID | 22979 | 8648 |
| Gene name | EFR3 homolog B | nuclear receptor coactivator 1 | |
| Synonyms | KIAA0953 | F-SRC-1|KAT13A|RIP160|SRC1|bHLHe42|bHLHe74 | |
| Cytomap | 2p23.3 | 2p23.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | protein EFR3 homolog B | nuclear receptor coactivator 1Hin-2 proteinclass E basic helix-loop-helix protein 74renal carcinoma antigen NY-REN-52steroid receptor coactivator-1 | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q9Y2G0 | Q15788 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000401432, ENST00000402191, ENST00000403714, ENST00000405108, | ENST00000288599, ENST00000348332, ENST00000395856, ENST00000405141, ENST00000407230, ENST00000469850, ENST00000538539, ENST00000406961, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 3 X 3 X 3=27 | 11 X 13 X 7=1001 |
| # samples | 3 | 13 | |
| ** MAII score | log2(3/27*10)=0.15200309344505 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | log2(13/1001*10)=-2.94485844580754 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: EFR3B [Title/Abstract] AND NCOA1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | EFR3B(25367920)-NCOA1(24962301), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | EFR3B-NCOA1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. EFR3B-NCOA1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. EFR3B-NCOA1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. EFR3B-NCOA1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. EFR3B-NCOA1 seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. EFR3B-NCOA1 seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. EFR3B-NCOA1 seems lost the major protein functional domain in Tgene partner, which is a epigenetic factor due to the frame-shifted ORF. EFR3B-NCOA1 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. EFR3B-NCOA1 seems lost the major protein functional domain in Tgene partner, which is a transcription factor due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | EFR3B | GO:0046854 | phosphatidylinositol phosphorylation | 23229899 |
| Hgene | EFR3B | GO:0072659 | protein localization to plasma membrane | 23229899 |
| Tgene | NCOA1 | GO:0000435 | positive regulation of transcription from RNA polymerase II promoter by galactose | 10207113 |
| Tgene | NCOA1 | GO:0006351 | transcription, DNA-templated | 9223431 |
| Tgene | NCOA1 | GO:0045893 | positive regulation of transcription, DNA-templated | 11891224|15367689 |
| Tgene | NCOA1 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 15919756 |
| Fusion gene breakpoints across EFR3B (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across NCOA1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BRCA | TCGA-AC-A8OQ-01A | EFR3B | chr2 | 25367920 | + | NCOA1 | chr2 | 24962301 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000403714 | EFR3B | chr2 | 25367920 | + | ENST00000406961 | NCOA1 | chr2 | 24962301 | + | 5761 | 2325 | 45 | 3449 | 1134 |
| ENST00000402191 | EFR3B | chr2 | 25367920 | + | ENST00000406961 | NCOA1 | chr2 | 24962301 | + | 5775 | 2339 | 17 | 3463 | 1148 |
| ENST00000405108 | EFR3B | chr2 | 25367920 | + | ENST00000406961 | NCOA1 | chr2 | 24962301 | + | 5331 | 1895 | 197 | 3019 | 940 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000403714 | ENST00000406961 | EFR3B | chr2 | 25367920 | + | NCOA1 | chr2 | 24962301 | + | 0.001448583 | 0.9985514 |
| ENST00000402191 | ENST00000406961 | EFR3B | chr2 | 25367920 | + | NCOA1 | chr2 | 24962301 | + | 0.001565698 | 0.99843425 |
| ENST00000405108 | ENST00000406961 | EFR3B | chr2 | 25367920 | + | NCOA1 | chr2 | 24962301 | + | 0.001898578 | 0.9981014 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >25408_25408_1_EFR3B-NCOA1_EFR3B_chr2_25367920_ENST00000402191_NCOA1_chr2_24962301_ENST00000406961_length(amino acids)=1148AA_BP=774 MRGQRCLGPGTLGSSPGPARAGAGRWSFGGRRLRGKRVSRSRADRECWRRWSCGSICGINKSGVCGCCGALRPRYKRLVDNIFPEDPEDG LVKTNMEKLTFYALSAPEKLDRIGAYLSERLIRDVGRHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVAKLLESEKPNLQILGTN SFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSHDDLEIKTKIRMSGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQHVEEA ESRSPSPLQAPEKEKESPAELAERCLRELLGRAAFGNIKNAIKPVLIHLDNHSLWEPKVFAIRCFKIIMYSIQPQHSHLVIQQLLGHLDA NSRSAATVRAGIVEVLSEAAVIAATGSVGPTVLEMFNTLLRQLRLSIDYALTGSYDGAVSLGTKIIKEHEERMFQEAVIKTVGSFASTLP TYQRSEVILFIMSKVPRPSLHQAVDTGRTGENRNRLTQIMLLKSLLQVSTGFQCNNMMSALPSNFLDRLLSTALMEDAEIRLFVLEILIS FIDRHGNRHKFSTISTLSDISVLKLKVDKCSRQDTVFMKKHSQQLYRHIYLSCKEETNVQKHYEALYGLLALISIELANEEVVVDLIRLV LAVQDVAQVNEENLPVYNRCALYALGAAYLNLISQLTTVPAFCQHIHEVIETRKKEAPYMLPEDVFVERPRLSQNLDGVVIELLFRQSKI SEVLGGSGYNSDRLCLPYIPQLTDEDRLSKRRSIGETISLQVEVESRNSPEKEELIHQNRQAILNQFAATAPVGINMRSGMQQQITPQPP LNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAAN PEASLANRNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPIPPPQSSLLQQTPPASGYQSPDMK AWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVSMAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSS -------------------------------------------------------------- >25408_25408_2_EFR3B-NCOA1_EFR3B_chr2_25367920_ENST00000403714_NCOA1_chr2_24962301_ENST00000406961_length(amino acids)=1134AA_BP=760 MLPPRPGPCRPPPVPAPTVNERRAPPRAGWERRSDAGLSRGARPAEMYGVCGCCGALRPRYKRLVDNIFPEDPEDGLVKTNMEKLTFYAL SAPEKLDRIGAYLSERLIRDVGRHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVAKLLESEKPNLQILGTNSFVKFANIEEDTPS YHRSYDFFVSRFSEMCHSSHDDLEIKTKIRMSGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQHVEEAESRSPSPLQAPEKE KESPAELAERCLRELLGRAAFGNIKNAIKPVLIHLDNHSLWEPKVFAIRCFKIIMYSIQPQHSHLVIQQLLGHLDANSRSAATVRAGIVE VLSEAAVIAATGSVGPTVLEMFNTLLRQLRLSIDYALTGSYDGAVSLGTKIIKEHEERMFQEAVIKTVGSFASTLPTYQRSEVILFIMSK VPRPSLHQAVDTGRTGENRNRLTQIMLLKSLLQVSTGFQCNNMMSALPSNFLDRLLSTALMEDAEIRLFVLEILISFIDRHGNRHKFSTI STLSDISVLKLKVDKCSRQDTVFMKKHSQQLYRHIYLSCKEETNVQKHYEALYGLLALISIELANEEVVVDLIRLVLAVQDVAQVNEENL PVYNRCALYALGAAYLNLISQLTTVPAFCQHIHEVIETRKKEAPYMLPEDVFVERPRLSQNLDGVVIELLFRQSKISEVLGGSGYNSDRL CLPYIPQLTDEDRLSKRRSIGETISLQVEVESRNSPEKEELIHQNRQAILNQFAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELY SQQHRQRQLIQQQRAMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLANRNSMVSR GMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPIPPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFS QAVQNQPTPAQPGVYNNMSITVSMAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTEADGTQQV -------------------------------------------------------------- >25408_25408_3_EFR3B-NCOA1_EFR3B_chr2_25367920_ENST00000405108_NCOA1_chr2_24962301_ENST00000406961_length(amino acids)=940AA_BP=566 MCHSSHDDLEIKTKIRMSGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQHVEEAESRSPSPLQAPEKEKESPAELAERCLRE LLGRAAFGNIKNAIKPVLIHLDNHSLWEPKVFAIRCFKIIMYSIQPQHSHLVIQQLLGHLDANSRSAATVRAGIVEVLSEAAVIAATGSV GPTVLEMFNTLLRQLRLSIDYALTGSYDGAVSLGTKIIKEHEERMFQEAVIKTVGSFASTLPTYQRSEVILFIMSKVPRPSLHQAVDTGR TGENRNRLTQIMLLKSLLQVSTGFQCNNMMSALPSNFLDRLLSTALMEDAEIRLFVLEILISFIDRHGNRHKFSTISTLSDISVLKLKVD KCSRQDTVFMKKHSQQLYRHIYLSCKEETNVQKHYEALYGLLALISIELANEEVVVDLIRLVLAVQDVAQVNEENLPVYNRCALYALGAA YLNLISQLTTVPAFCQHIHEVIETRKKEAPYMLPEDVFVERPRLSQNLDGVVIELLFRQSKISEVLGGSGYNSDRLCLPYIPQLTDEDRL SKRRSIGETISLQVEVESRNSPEKEELIHQNRQAILNQFAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQR AMLMRQQSFGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLANRNSMVSRGMTGNIGGQFGTGI NPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPIPPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGV YNNMSITVSMAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTEADGTQQVQQVQVFADVQCTVN -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:25367920/chr2:24962301) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| EFR3B | NCOA1 |
| FUNCTION: Component of a complex required to localize phosphatidylinositol 4-kinase (PI4K) to the plasma membrane (PubMed:23229899, PubMed:25608530, PubMed:26571211). The complex acts as a regulator of phosphatidylinositol 4-phosphate (PtdIns(4)P) synthesis (Probable). In the complex, EFR3B probably acts as the membrane-anchoring component (PubMed:23229899). Also involved in responsiveness to G-protein-coupled receptors; it is however unclear whether this role is direct or indirect (PubMed:25380825). {ECO:0000269|PubMed:23229899, ECO:0000269|PubMed:25380825, ECO:0000269|PubMed:25608530, ECO:0000269|PubMed:26571211, ECO:0000305}. | FUNCTION: Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Involved in the coactivation of different nuclear receptors, such as for steroids (PGR, GR and ER), retinoids (RXRs), thyroid hormone (TRs) and prostanoids (PPARs). Also involved in coactivation mediated by STAT3, STAT5A, STAT5B and STAT6 transcription factors. Displays histone acetyltransferase activity toward H3 and H4; the relevance of such activity remains however unclear. Plays a central role in creating multisubunit coactivator complexes that act via remodeling of chromatin, and possibly acts by participating in both chromatin remodeling and recruitment of general transcription factors. Required with NCOA2 to control energy balance between white and brown adipose tissues. Required for mediating steroid hormone response. Isoform 2 has a higher thyroid hormone-dependent transactivation activity than isoform 1 and isoform 3. {ECO:0000269|PubMed:10449719, ECO:0000269|PubMed:12954634, ECO:0000269|PubMed:7481822, ECO:0000269|PubMed:9223281, ECO:0000269|PubMed:9223431, ECO:0000269|PubMed:9296499, ECO:0000269|PubMed:9427757}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000288599 | 14 | 22 | 1435_1439 | 1067.0 | 2199.3333333333335 | Motif | Note=LXXLL motif 7 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000348332 | 14 | 21 | 1435_1439 | 1067.0 | 1442.0 | Motif | Note=LXXLL motif 7 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000395856 | 14 | 21 | 1435_1439 | 1067.0 | 1441.0 | Motif | Note=LXXLL motif 7 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000405141 | 17 | 25 | 1435_1439 | 1067.0 | 2183.6666666666665 | Motif | Note=LXXLL motif 7 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000406961 | 16 | 23 | 1435_1439 | 1067.0 | 1442.0 | Motif | Note=LXXLL motif 7 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000538539 | 15 | 23 | 1435_1439 | 1067.0 | 1422.6666666666667 | Motif | Note=LXXLL motif 7 |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000288599 | 14 | 22 | 1053_1138 | 1067.0 | 2199.3333333333335 | Compositional bias | Note=Gln-rich | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000288599 | 14 | 22 | 389_682 | 1067.0 | 2199.3333333333335 | Compositional bias | Note=Ser-rich | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000348332 | 14 | 21 | 1053_1138 | 1067.0 | 1442.0 | Compositional bias | Note=Gln-rich | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000348332 | 14 | 21 | 389_682 | 1067.0 | 1442.0 | Compositional bias | Note=Ser-rich | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000395856 | 14 | 21 | 1053_1138 | 1067.0 | 1441.0 | Compositional bias | Note=Gln-rich | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000395856 | 14 | 21 | 389_682 | 1067.0 | 1441.0 | Compositional bias | Note=Ser-rich | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000405141 | 17 | 25 | 1053_1138 | 1067.0 | 2183.6666666666665 | Compositional bias | Note=Gln-rich | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000405141 | 17 | 25 | 389_682 | 1067.0 | 2183.6666666666665 | Compositional bias | Note=Ser-rich | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000406961 | 16 | 23 | 1053_1138 | 1067.0 | 1442.0 | Compositional bias | Note=Gln-rich | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000406961 | 16 | 23 | 389_682 | 1067.0 | 1442.0 | Compositional bias | Note=Ser-rich | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000538539 | 15 | 23 | 1053_1138 | 1067.0 | 1422.6666666666667 | Compositional bias | Note=Gln-rich | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000538539 | 15 | 23 | 389_682 | 1067.0 | 1422.6666666666667 | Compositional bias | Note=Ser-rich | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000288599 | 14 | 22 | 109_180 | 1067.0 | 2199.3333333333335 | Domain | PAS | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000288599 | 14 | 22 | 23_80 | 1067.0 | 2199.3333333333335 | Domain | bHLH | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000348332 | 14 | 21 | 109_180 | 1067.0 | 1442.0 | Domain | PAS | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000348332 | 14 | 21 | 23_80 | 1067.0 | 1442.0 | Domain | bHLH | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000395856 | 14 | 21 | 109_180 | 1067.0 | 1441.0 | Domain | PAS | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000395856 | 14 | 21 | 23_80 | 1067.0 | 1441.0 | Domain | bHLH | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000405141 | 17 | 25 | 109_180 | 1067.0 | 2183.6666666666665 | Domain | PAS | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000405141 | 17 | 25 | 23_80 | 1067.0 | 2183.6666666666665 | Domain | bHLH | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000406961 | 16 | 23 | 109_180 | 1067.0 | 1442.0 | Domain | PAS | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000406961 | 16 | 23 | 23_80 | 1067.0 | 1442.0 | Domain | bHLH | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000538539 | 15 | 23 | 109_180 | 1067.0 | 1422.6666666666667 | Domain | PAS | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000538539 | 15 | 23 | 23_80 | 1067.0 | 1422.6666666666667 | Domain | bHLH | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000288599 | 14 | 22 | 112_116 | 1067.0 | 2199.3333333333335 | Motif | Note=LXXLL motif 2 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000288599 | 14 | 22 | 46_50 | 1067.0 | 2199.3333333333335 | Motif | Note=LXXLL motif 1 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000288599 | 14 | 22 | 633_637 | 1067.0 | 2199.3333333333335 | Motif | Note=LXXLL motif 3 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000288599 | 14 | 22 | 690_694 | 1067.0 | 2199.3333333333335 | Motif | Note=LXXLL motif 4 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000288599 | 14 | 22 | 749_753 | 1067.0 | 2199.3333333333335 | Motif | Note=LXXLL motif 5 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000288599 | 14 | 22 | 913_917 | 1067.0 | 2199.3333333333335 | Motif | Note=LXXLL motif 6 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000348332 | 14 | 21 | 112_116 | 1067.0 | 1442.0 | Motif | Note=LXXLL motif 2 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000348332 | 14 | 21 | 46_50 | 1067.0 | 1442.0 | Motif | Note=LXXLL motif 1 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000348332 | 14 | 21 | 633_637 | 1067.0 | 1442.0 | Motif | Note=LXXLL motif 3 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000348332 | 14 | 21 | 690_694 | 1067.0 | 1442.0 | Motif | Note=LXXLL motif 4 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000348332 | 14 | 21 | 749_753 | 1067.0 | 1442.0 | Motif | Note=LXXLL motif 5 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000348332 | 14 | 21 | 913_917 | 1067.0 | 1442.0 | Motif | Note=LXXLL motif 6 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000395856 | 14 | 21 | 112_116 | 1067.0 | 1441.0 | Motif | Note=LXXLL motif 2 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000395856 | 14 | 21 | 46_50 | 1067.0 | 1441.0 | Motif | Note=LXXLL motif 1 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000395856 | 14 | 21 | 633_637 | 1067.0 | 1441.0 | Motif | Note=LXXLL motif 3 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000395856 | 14 | 21 | 690_694 | 1067.0 | 1441.0 | Motif | Note=LXXLL motif 4 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000395856 | 14 | 21 | 749_753 | 1067.0 | 1441.0 | Motif | Note=LXXLL motif 5 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000395856 | 14 | 21 | 913_917 | 1067.0 | 1441.0 | Motif | Note=LXXLL motif 6 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000405141 | 17 | 25 | 112_116 | 1067.0 | 2183.6666666666665 | Motif | Note=LXXLL motif 2 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000405141 | 17 | 25 | 46_50 | 1067.0 | 2183.6666666666665 | Motif | Note=LXXLL motif 1 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000405141 | 17 | 25 | 633_637 | 1067.0 | 2183.6666666666665 | Motif | Note=LXXLL motif 3 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000405141 | 17 | 25 | 690_694 | 1067.0 | 2183.6666666666665 | Motif | Note=LXXLL motif 4 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000405141 | 17 | 25 | 749_753 | 1067.0 | 2183.6666666666665 | Motif | Note=LXXLL motif 5 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000405141 | 17 | 25 | 913_917 | 1067.0 | 2183.6666666666665 | Motif | Note=LXXLL motif 6 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000406961 | 16 | 23 | 112_116 | 1067.0 | 1442.0 | Motif | Note=LXXLL motif 2 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000406961 | 16 | 23 | 46_50 | 1067.0 | 1442.0 | Motif | Note=LXXLL motif 1 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000406961 | 16 | 23 | 633_637 | 1067.0 | 1442.0 | Motif | Note=LXXLL motif 3 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000406961 | 16 | 23 | 690_694 | 1067.0 | 1442.0 | Motif | Note=LXXLL motif 4 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000406961 | 16 | 23 | 749_753 | 1067.0 | 1442.0 | Motif | Note=LXXLL motif 5 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000406961 | 16 | 23 | 913_917 | 1067.0 | 1442.0 | Motif | Note=LXXLL motif 6 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000538539 | 15 | 23 | 112_116 | 1067.0 | 1422.6666666666667 | Motif | Note=LXXLL motif 2 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000538539 | 15 | 23 | 46_50 | 1067.0 | 1422.6666666666667 | Motif | Note=LXXLL motif 1 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000538539 | 15 | 23 | 633_637 | 1067.0 | 1422.6666666666667 | Motif | Note=LXXLL motif 3 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000538539 | 15 | 23 | 690_694 | 1067.0 | 1422.6666666666667 | Motif | Note=LXXLL motif 4 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000538539 | 15 | 23 | 749_753 | 1067.0 | 1422.6666666666667 | Motif | Note=LXXLL motif 5 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000538539 | 15 | 23 | 913_917 | 1067.0 | 1422.6666666666667 | Motif | Note=LXXLL motif 6 |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| EFR3B | |
| NCOA1 |  |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000288599 | 14 | 22 | 781_988 | 1067.0 | 2199.3333333333335 | CREBBP | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000348332 | 14 | 21 | 781_988 | 1067.0 | 1442.0 | CREBBP | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000395856 | 14 | 21 | 781_988 | 1067.0 | 1441.0 | CREBBP | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000405141 | 17 | 25 | 781_988 | 1067.0 | 2183.6666666666665 | CREBBP | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000406961 | 16 | 23 | 781_988 | 1067.0 | 1442.0 | CREBBP | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000538539 | 15 | 23 | 781_988 | 1067.0 | 1422.6666666666667 | CREBBP | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000288599 | 14 | 22 | 361_567 | 1067.0 | 2199.3333333333335 | STAT3 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000348332 | 14 | 21 | 361_567 | 1067.0 | 1442.0 | STAT3 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000395856 | 14 | 21 | 361_567 | 1067.0 | 1441.0 | STAT3 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000405141 | 17 | 25 | 361_567 | 1067.0 | 2183.6666666666665 | STAT3 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000406961 | 16 | 23 | 361_567 | 1067.0 | 1442.0 | STAT3 | |
| Tgene | NCOA1 | chr2:25367920 | chr2:24962301 | ENST00000538539 | 15 | 23 | 361_567 | 1067.0 | 1422.6666666666667 | STAT3 |
Top |
Related Drugs to EFR3B-NCOA1 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to EFR3B-NCOA1 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Tgene | NCOA1 | C0006142 | Malignant neoplasm of breast | 1 | CTD_human |
| Tgene | NCOA1 | C0014175 | Endometriosis | 1 | CTD_human |
| Tgene | NCOA1 | C0024668 | Mammary Neoplasms, Experimental | 1 | CTD_human |
| Tgene | NCOA1 | C0027627 | Neoplasm Metastasis | 1 | CTD_human |
| Tgene | NCOA1 | C0033578 | Prostatic Neoplasms | 1 | CTD_human |
| Tgene | NCOA1 | C0269102 | Endometrioma | 1 | CTD_human |
| Tgene | NCOA1 | C0376358 | Malignant neoplasm of prostate | 1 | CTD_human |
| Tgene | NCOA1 | C0678222 | Breast Carcinoma | 1 | CTD_human |
| Tgene | NCOA1 | C1257931 | Mammary Neoplasms, Human | 1 | CTD_human |
| Tgene | NCOA1 | C1458155 | Mammary Neoplasms | 1 | CTD_human |
| Tgene | NCOA1 | C4704874 | Mammary Carcinoma, Human | 1 | CTD_human |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies