| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:EIF2AK4-FEM1B |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: EIF2AK4-FEM1B | FusionPDB ID: 25678 | FusionGDB2.0 ID: 25678 | Hgene | Tgene | Gene symbol | EIF2AK4 | FEM1B | Gene ID | 440275 | 10116 |
| Gene name | eukaryotic translation initiation factor 2 alpha kinase 4 | fem-1 homolog B | |
| Synonyms | GCN2|PVOD2 | F1A-ALPHA|F1AA|FEM1-beta | |
| Cytomap | 15q15.1 | 15q23 | |
| Type of gene | protein-coding | protein-coding | |
| Description | eIF-2-alpha kinase GCN2GCN2 eIF2alpha kinaseGCN2-like proteingeneral control nonderepressible 2 | protein fem-1 homolog BFEM-1-like death receptor binding proteinfem-1-like death receptor-binding protein alphafem-1-like in apoptotic pathway protein alpha | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q9P2K8 | Q9UK73 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000263791, ENST00000382727, ENST00000559311, ENST00000559624, ENST00000560648, | ENST00000306917, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 15 X 17 X 10=2550 | 6 X 5 X 3=90 |
| # samples | 20 | 6 | |
| ** MAII score | log2(20/2550*10)=-3.6724253419715 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(6/90*10)=-0.584962500721156 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: EIF2AK4 [Title/Abstract] AND FEM1B [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | EIF2AK4(40314806)-FEM1B(68581945), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | EIF2AK4-FEM1B seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. EIF2AK4-FEM1B seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. EIF2AK4-FEM1B seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. EIF2AK4-FEM1B seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Fusion gene breakpoints across EIF2AK4 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across FEM1B (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | LUSC | TCGA-43-8116-01A | EIF2AK4 | chr15 | 40314806 | + | FEM1B | chr15 | 68581945 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000382727 | EIF2AK4 | chr15 | 40314806 | + | ENST00000306917 | FEM1B | chr15 | 68581945 | + | 10614 | 4355 | 50 | 4366 | 1438 |
| ENST00000263791 | EIF2AK4 | chr15 | 40314806 | + | ENST00000306917 | FEM1B | chr15 | 68581945 | + | 10691 | 4432 | 43 | 4443 | 1466 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000382727 | ENST00000306917 | EIF2AK4 | chr15 | 40314806 | + | FEM1B | chr15 | 68581945 | + | 0.000126432 | 0.9998735 |
| ENST00000263791 | ENST00000306917 | EIF2AK4 | chr15 | 40314806 | + | FEM1B | chr15 | 68581945 | + | 0.000170833 | 0.9998292 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >25678_25678_1_EIF2AK4-FEM1B_EIF2AK4_chr15_40314806_ENST00000263791_FEM1B_chr15_68581945_ENST00000306917_length(amino acids)=1466AA_BP= MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLYPQGLTGEEVYVKVDLRVKCPPTYPDVVPEI ELKNAKGLSNESVNLLKSRLEELAKKHCGEVMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIQ RRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSKKDPGGHRTAAILHGGSPDFVGNGKHRANSSGRSRRERQYSVCNSEDSPGSCEILYF NMGSPDQLMVHKGKCIGSDEQLGKLVYNALETATGGFVLLYEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTETEFNSLVKLSHPNVVR YLAMNLKEQDDSIVVDILVEHISGVSLAAHLSHSGPIPVHQLRRYTAQLLSGLDYLHSNSVVHKVLSASNVLVDAEGTVKITDYSISKRL ADICKEDVFEQTRVRFSDNALPYKTGKKGDVWRLGLLLLSLSQGQECGEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN PQPKMPLVEQSPEDSEGQDYVETVIPSNRLPSAAFFSETQRQFSRYFIEFEELQLLGKGAFGAVIKVQNKLDGCCYAVKRIPINPASRQF RRIKGEVTLLSRLHHENIVRYYNAWIERHERPAGPGTPPPDSGPLAKDDRAARGQPASDTDGLDSVEAAAPPPILSSSVEWSTSGERSAS ARFPATGPGSSDDEDDDEDEHGGVFSQSFLPASDSESDIIFDNEDENSKSQNQDEDCNEKNGCHESEPSVTTEAVHYLYIQMEYCEKSTL RDTIDQGLYRDTVRLWRLFREILDGLAYIHEKGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFSADSKQDDQTGDLIKSDPSGHLTG MVGTALYVSPEVQGSTKSAYNQKVDLFSLGIIFFEMSYHPMVTASERIFVLNQLRDPTSPKFPEDFDDGEHAKQKSVISWLLNHDPAKRP TATELLKSELLPPPQMEESELHEVLHHTLTNVDGKAYRTMMAQIFSQRISPAIDYTYDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGA VQLCTPLLLPRNRQIYEHNEAALFMDHSGMLVMLPFDLRIPFARYVARNNILNLKRYCIERVFRPRKLDRFHPKELLECAFDIVTSTTNS FLPTAEIIYTIYEIIQEFPALQERNYSIYLNHTMLLKAILLHCGIPEDKLSQVYIILYDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKF IEQKGDLQDLMPTINSLIKQKTGIAQLVKYGLKDLEEVVGLLKKLGIKLQVLINLGLVYKVQQHNGIIFQFVAFIKRRQRAVPEILAAGG RYDLLIPQFRGPQALGPVPTAIGVSIAIDKISAAVLNMEESVTISSCDLLVVSVGQMSMSRAINLTQKLWTAGITAEIMYDWSQSQEELQ -------------------------------------------------------------- >25678_25678_2_EIF2AK4-FEM1B_EIF2AK4_chr15_40314806_ENST00000382727_FEM1B_chr15_68581945_ENST00000306917_length(amino acids)=1438AA_BP= MAGGRGAPGRGRDEPPESYPQRQDHELQALEAIYGADFQDLRPDACGPVKEPPEINLVLYPQGLTGEEVYVKVDLRVKCPPTYPDVVPEI ELKNAKGLSNESVNLLKSRLEELAKKHCGEVMIFELAYHVQSFLSEHNKPPPKSFHEEMLERRAQEEQQRLLEAKRKEEQEQREILHEIQ RRKEEIKEEKKRKEMAKQERLEIASLSNQDHTSKKDPGGHRTAAILHGGSPDFVGNGKHRANSSGRSRRERQYSVCNSEDSPGSCEILYF NMGSPDQLMVHKGKCIGSDEQLGKLVYNALETATGGFVLLYEWVLQWQKKMGPFLTSQEKEKIDKCKKQIQGTETEFNSLVKLSHPNVVR YLAMNLKEQDDSIVVDILVEHISGVSLAAHLSHSGPIPVHQLRRYTAQLLSGLDYLHSNSVVHKVLSASNVLVDAEGTVKITDYSISKRL ADICKEDVFEQTRVRFSDNALPYKTGKKGDVWRLGLLLLSLSQGQECGEYPVTIPSDLPADFQDFLKKCVCLDDKERWSPQQLLKHSFIN PQPKMPLVEQSPEDSEGQDYVETVIPSNRLPSAAFFSETQRQFSRYFIEFEELQLLGKGAFGAVIKVQNKLDGCCYAVKRIPINPASRQF RRIKGEVTLLSRLHHENIVRYYNAWIERHERPAGPGTPPPDSGPLAKDDRAARGQPASDTDGLDSVEAAAPPPILSSSVEWSTSGERSAS ARFPATGPGSSDDEDDDEDEHGGVFSQSFLPASDSESDIIFDNEDENSKSQNQMEYCEKSTLRDTIDQGLYRDTVRLWRLFREILDGLAY IHEKGMIHRDLKPVNIFLDSDDHVKIGDFGLATDHLAFSADSKQDDQTGDLIKSDPSGHLTGMVGTALYVSPEVQGSTKSAYNQKVDLFS LGIIFFEMSYHPMVTASERIFVLNQLRDPTSPKFPEDFDDGEHAKQKSVISWLLNHDPAKRPTATELLKSELLPPPQMEESELHEVLHHT LTNVDGKAYRTMMAQIFSQRISPAIDYTYDSDILKGNFSIRTAKMQQHVCETIIRIFKRHGAVQLCTPLLLPRNRQIYEHNEAALFMDHS GMLVMLPFDLRIPFARYVARNNILNLKRYCIERVFRPRKLDRFHPKELLECAFDIVTSTTNSFLPTAEIIYTIYEIIQEFPALQERNYSI YLNHTMLLKAILLHCGIPEDKLSQVYIILYDAVTEKLTRREVEAKFCNLSLSSNSLCRLYKFIEQKGDLQDLMPTINSLIKQKTGIAQLV KYGLKDLEEVVGLLKKLGIKLQVLINLGLVYKVQQHNGIIFQFVAFIKRRQRAVPEILAAGGRYDLLIPQFRGPQALGPVPTAIGVSIAI -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr15:40314806/chr15:68581945) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| EIF2AK4 | FEM1B |
| FUNCTION: Metabolic-stress sensing protein kinase that phosphorylates the alpha subunit of eukaryotic translation initiation factor 2 (EIF2S1/eIF-2-alpha) in response to low amino acid availability (PubMed:25329545). Plays a role as an activator of the integrated stress response (ISR) required for adaptation to amino acid starvation (By similarity). EIF2S1/eIF-2-alpha phosphorylation in response to stress converts EIF2S1/eIF-2-alpha in a global protein synthesis inhibitor, leading to a global attenuation of cap-dependent translation, and thus to a reduced overall utilization of amino acids, while concomitantly initiating the preferential translation of ISR-specific mRNAs, such as the transcriptional activator ATF4, and hence allowing ATF4-mediated reprogramming of amino acid biosynthetic gene expression to alleviate nutrient depletion (By similarity). Binds uncharged tRNAs (By similarity). Involved in cell cycle arrest by promoting cyclin D1 mRNA translation repression after the unfolded protein response pathway (UPR) activation or cell cycle inhibitor CDKN1A/p21 mRNA translation activation in response to amino acid deprivation (PubMed:26102367). Plays a role in the consolidation of synaptic plasticity, learning as well as formation of long-term memory (By similarity). Plays a role in neurite outgrowth inhibition (By similarity). Plays a proapoptotic role in response to glucose deprivation (By similarity). Promotes global cellular protein synthesis repression in response to UV irradiation independently of the stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK) and p38 MAPK signaling pathways (By similarity). Plays a role in the antiviral response against alphavirus infection; impairs early viral mRNA translation of the incoming genomic virus RNA, thus preventing alphavirus replication (By similarity). {ECO:0000250|UniProtKB:P15442, ECO:0000250|UniProtKB:Q9QZ05, ECO:0000269|PubMed:25329545, ECO:0000269|PubMed:26102367}.; FUNCTION: (Microbial infection) Plays a role in modulating the adaptive immune response to yellow fever virus infection; promotes dendritic cells to initiate autophagy and antigene presentation to both CD4(+) and CD8(+) T-cells under amino acid starvation (PubMed:24310610). {ECO:0000269|PubMed:24310610}. | FUNCTION: Component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. Involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. Also involved in glucose homeostasis in pancreatic islet. Functions as an adapter/mediator in replication stress-induced signaling that leads to the activation of CHEK1. {ECO:0000269|PubMed:10542291, ECO:0000269|PubMed:19330022}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000263791 | + | 32 | 39 | 146_205 | 1463.0 | 1650.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000382727 | + | 31 | 38 | 146_205 | 1435.0 | 1622.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000263791 | + | 32 | 39 | 484_491 | 1463.0 | 1650.0 | Compositional bias | Note=Poly-Leu |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000382727 | + | 31 | 38 | 484_491 | 1435.0 | 1622.0 | Compositional bias | Note=Poly-Leu |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000263791 | + | 32 | 39 | 25_137 | 1463.0 | 1650.0 | Domain | RWD |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000263791 | + | 32 | 39 | 296_539 | 1463.0 | 1650.0 | Domain | Protein kinase 1 |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000263791 | + | 32 | 39 | 590_1001 | 1463.0 | 1650.0 | Domain | Protein kinase 2 |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000382727 | + | 31 | 38 | 25_137 | 1435.0 | 1622.0 | Domain | RWD |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000382727 | + | 31 | 38 | 296_539 | 1435.0 | 1622.0 | Domain | Protein kinase 1 |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000382727 | + | 31 | 38 | 590_1001 | 1435.0 | 1622.0 | Domain | Protein kinase 2 |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000263791 | + | 32 | 39 | 596_604 | 1463.0 | 1650.0 | Nucleotide binding | ATP |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000382727 | + | 31 | 38 | 596_604 | 1435.0 | 1622.0 | Nucleotide binding | ATP |
| Tgene | FEM1B | chr15:40314806 | chr15:68581945 | ENST00000306917 | 0 | 2 | 120_149 | 82.66666666666667 | 628.0 | Repeat | Note=ANK 3 | |
| Tgene | FEM1B | chr15:40314806 | chr15:68581945 | ENST00000306917 | 0 | 2 | 153_182 | 82.66666666666667 | 628.0 | Repeat | Note=ANK 4 | |
| Tgene | FEM1B | chr15:40314806 | chr15:68581945 | ENST00000306917 | 0 | 2 | 186_215 | 82.66666666666667 | 628.0 | Repeat | Note=ANK 5 | |
| Tgene | FEM1B | chr15:40314806 | chr15:68581945 | ENST00000306917 | 0 | 2 | 218_248 | 82.66666666666667 | 628.0 | Repeat | Note=ANK 6 | |
| Tgene | FEM1B | chr15:40314806 | chr15:68581945 | ENST00000306917 | 0 | 2 | 344_377 | 82.66666666666667 | 628.0 | Repeat | Note=TPR | |
| Tgene | FEM1B | chr15:40314806 | chr15:68581945 | ENST00000306917 | 0 | 2 | 483_527 | 82.66666666666667 | 628.0 | Repeat | Note=ANK 7 | |
| Tgene | FEM1B | chr15:40314806 | chr15:68581945 | ENST00000306917 | 0 | 2 | 531_568 | 82.66666666666667 | 628.0 | Repeat | Note=ANK 8 | |
| Tgene | FEM1B | chr15:40314806 | chr15:68581945 | ENST00000306917 | 0 | 2 | 87_116 | 82.66666666666667 | 628.0 | Repeat | Note=ANK 2 |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000559624 | + | 1 | 11 | 146_205 | 0 | 617.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000559624 | + | 1 | 11 | 484_491 | 0 | 617.0 | Compositional bias | Note=Poly-Leu |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000559624 | + | 1 | 11 | 25_137 | 0 | 617.0 | Domain | RWD |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000559624 | + | 1 | 11 | 296_539 | 0 | 617.0 | Domain | Protein kinase 1 |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000559624 | + | 1 | 11 | 590_1001 | 0 | 617.0 | Domain | Protein kinase 2 |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000559624 | + | 1 | 11 | 596_604 | 0 | 617.0 | Nucleotide binding | ATP |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000263791 | + | 32 | 39 | 1022_1493 | 1463.0 | 1650.0 | Region | Note=Histidyl-tRNA synthetase-like |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000382727 | + | 31 | 38 | 1022_1493 | 1435.0 | 1622.0 | Region | Note=Histidyl-tRNA synthetase-like |
| Hgene | EIF2AK4 | chr15:40314806 | chr15:68581945 | ENST00000559624 | + | 1 | 11 | 1022_1493 | 0 | 617.0 | Region | Note=Histidyl-tRNA synthetase-like |
| Tgene | FEM1B | chr15:40314806 | chr15:68581945 | ENST00000306917 | 0 | 2 | 45_74 | 82.66666666666667 | 628.0 | Repeat | Note=ANK 1 |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| EIF2AK4 | |
| FEM1B |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to EIF2AK4-FEM1B |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to EIF2AK4-FEM1B |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies