| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:EIF4A2-HIF1A |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: EIF4A2-HIF1A | FusionPDB ID: 25934 | FusionGDB2.0 ID: 25934 | Hgene | Tgene | Gene symbol | EIF4A2 | HIF1A | Gene ID | 1974 | 3091 |
| Gene name | eukaryotic translation initiation factor 4A2 | hypoxia inducible factor 1 subunit alpha | |
| Synonyms | BM-010|DDX2B|EIF4A|EIF4F|eIF-4A-II|eIF4A-II | HIF-1-alpha|HIF-1A|HIF-1alpha|HIF1|HIF1-ALPHA|MOP1|PASD8|bHLHe78 | |
| Cytomap | 3q27.3 | 14q23.2 | |
| Type of gene | protein-coding | protein-coding | |
| Description | eukaryotic initiation factor 4A-IIATP-dependent RNA helicase eIF4A-2 | hypoxia-inducible factor 1-alphaARNT interacting proteinPAS domain-containing protein 8basic-helix-loop-helix-PAS protein MOP1class E basic helix-loop-helix protein 78hypoxia inducible factor 1 alpha subunithypoxia inducible factor 1, alpha subunit | |
| Modification date | 20200322 | 20200329 | |
| UniProtAcc | Q14240 | Q9NWT6 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000323963, ENST00000356531, ENST00000440191, | ENST00000557206, ENST00000323441, ENST00000539097, ENST00000557538, ENST00000337138, ENST00000394997, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 21 X 21 X 7=3087 | 7 X 7 X 3=147 |
| # samples | 23 | 7 | |
| ** MAII score | log2(23/3087*10)=-3.74649971667075 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(7/147*10)=-1.0703893278914 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: EIF4A2 [Title/Abstract] AND HIF1A [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | EIF4A2(186505373)-HIF1A(62213652), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | EIF4A2-HIF1A seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. EIF4A2-HIF1A seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. EIF4A2-HIF1A seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. EIF4A2-HIF1A seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. EIF4A2-HIF1A seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. EIF4A2-HIF1A seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. EIF4A2-HIF1A seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. EIF4A2-HIF1A seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. EIF4A2-HIF1A seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. EIF4A2-HIF1A seems lost the major protein functional domain in Tgene partner, which is a transcription factor due to the frame-shifted ORF. EIF4A2-HIF1A seems lost the major protein functional domain in Tgene partner, which is a tumor suppressor due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | EIF4A2 | GO:1900260 | negative regulation of RNA-directed 5'-3' RNA polymerase activity | 11922617 |
| Tgene | HIF1A | GO:0001666 | response to hypoxia | 8756616|9887100|11782478|15261140|18419598 |
| Tgene | HIF1A | GO:0006355 | regulation of transcription, DNA-templated | 11782478|15261140 |
| Tgene | HIF1A | GO:0010468 | regulation of gene expression | 18419598 |
| Tgene | HIF1A | GO:0010573 | vascular endothelial growth factor production | 12958148 |
| Tgene | HIF1A | GO:0010575 | positive regulation of vascular endothelial growth factor production | 8756616 |
| Tgene | HIF1A | GO:0010628 | positive regulation of gene expression | 15459207|24244340 |
| Tgene | HIF1A | GO:0032364 | oxygen homeostasis | 16956324 |
| Tgene | HIF1A | GO:0043619 | regulation of transcription from RNA polymerase II promoter in response to oxidative stress | 8089148|8387214 |
| Tgene | HIF1A | GO:0045893 | positive regulation of transcription, DNA-templated | 8089148|9887100|25043030 |
| Tgene | HIF1A | GO:0045944 | positive regulation of transcription by RNA polymerase II | 11573933 |
| Tgene | HIF1A | GO:0046886 | positive regulation of hormone biosynthetic process | 1448077 |
| Tgene | HIF1A | GO:0061419 | positive regulation of transcription from RNA polymerase II promoter in response to hypoxia | 22735262 |
| Tgene | HIF1A | GO:0071456 | cellular response to hypoxia | 11573933|19528298|20889502 |
| Tgene | HIF1A | GO:1902895 | positive regulation of pri-miRNA transcription by RNA polymerase II | 19782034 |
| Tgene | HIF1A | GO:1903377 | negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway | 24899725 |
| Fusion gene breakpoints across EIF4A2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across HIF1A (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | STAD | TCGA-HU-A4GT-01A | EIF4A2 | chr3 | 186505373 | + | HIF1A | chr14 | 62213652 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000323963 | EIF4A2 | chr3 | 186505373 | + | ENST00000394997 | HIF1A | chr14 | 62213652 | + | 2388 | 1063 | 64 | 1068 | 334 |
| ENST00000323963 | EIF4A2 | chr3 | 186505373 | + | ENST00000337138 | HIF1A | chr14 | 62213652 | + | 2388 | 1063 | 64 | 1068 | 334 |
| ENST00000440191 | EIF4A2 | chr3 | 186505373 | + | ENST00000394997 | HIF1A | chr14 | 62213652 | + | 2361 | 1036 | 34 | 1041 | 335 |
| ENST00000440191 | EIF4A2 | chr3 | 186505373 | + | ENST00000337138 | HIF1A | chr14 | 62213652 | + | 2361 | 1036 | 34 | 1041 | 335 |
| ENST00000356531 | EIF4A2 | chr3 | 186505373 | + | ENST00000394997 | HIF1A | chr14 | 62213652 | + | 2201 | 876 | 162 | 881 | 239 |
| ENST00000356531 | EIF4A2 | chr3 | 186505373 | + | ENST00000337138 | HIF1A | chr14 | 62213652 | + | 2201 | 876 | 162 | 881 | 239 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000323963 | ENST00000394997 | EIF4A2 | chr3 | 186505373 | + | HIF1A | chr14 | 62213652 | + | 0.000245261 | 0.9997547 |
| ENST00000323963 | ENST00000337138 | EIF4A2 | chr3 | 186505373 | + | HIF1A | chr14 | 62213652 | + | 0.000245261 | 0.9997547 |
| ENST00000440191 | ENST00000394997 | EIF4A2 | chr3 | 186505373 | + | HIF1A | chr14 | 62213652 | + | 0.000211576 | 0.99978846 |
| ENST00000440191 | ENST00000337138 | EIF4A2 | chr3 | 186505373 | + | HIF1A | chr14 | 62213652 | + | 0.000211576 | 0.99978846 |
| ENST00000356531 | ENST00000394997 | EIF4A2 | chr3 | 186505373 | + | HIF1A | chr14 | 62213652 | + | 0.000308458 | 0.9996916 |
| ENST00000356531 | ENST00000337138 | EIF4A2 | chr3 | 186505373 | + | HIF1A | chr14 | 62213652 | + | 0.000308458 | 0.9996916 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >25934_25934_1_EIF4A2-HIF1A_EIF4A2_chr3_186505373_ENST00000323963_HIF1A_chr14_62213652_ENST00000337138_length(amino acids)=334AA_BP= MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAIS ILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMF VLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYET -------------------------------------------------------------- >25934_25934_2_EIF4A2-HIF1A_EIF4A2_chr3_186505373_ENST00000323963_HIF1A_chr14_62213652_ENST00000394997_length(amino acids)=334AA_BP= MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAIS ILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMF VLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYET -------------------------------------------------------------- >25934_25934_3_EIF4A2-HIF1A_EIF4A2_chr3_186505373_ENST00000356531_HIF1A_chr14_62213652_ENST00000337138_length(amino acids)=239AA_BP= MLTVLRSLPLFSRELLFPVLKIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEA DEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQ -------------------------------------------------------------- >25934_25934_4_EIF4A2-HIF1A_EIF4A2_chr3_186505373_ENST00000356531_HIF1A_chr14_62213652_ENST00000394997_length(amino acids)=239AA_BP= MLTVLRSLPLFSRELLFPVLKIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEA DEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQ -------------------------------------------------------------- >25934_25934_5_EIF4A2-HIF1A_EIF4A2_chr3_186505373_ENST00000440191_HIF1A_chr14_62213652_ENST00000337138_length(amino acids)=335AA_BP= MSGGSADYNSREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAI SILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKM FVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYE -------------------------------------------------------------- >25934_25934_6_EIF4A2-HIF1A_EIF4A2_chr3_186505373_ENST00000440191_HIF1A_chr14_62213652_ENST00000394997_length(amino acids)=335AA_BP= MSGGSADYNSREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAI SILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNVRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKM FVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYE -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr3:186505373/chr14:62213652) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| EIF4A2 | HIF1A |
| FUNCTION: ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon. | FUNCTION: Hydroxylates HIF-1 alpha at 'Asn-803' in the C-terminal transactivation domain (CAD). Functions as an oxygen sensor and, under normoxic conditions, the hydroxylation prevents interaction of HIF-1 with transcriptional coactivators including Cbp/p300-interacting transactivator. Involved in transcriptional repression through interaction with HIF1A, VHL and histone deacetylases. Hydroxylates specific Asn residues within ankyrin repeat domains (ARD) of NFKB1, NFKBIA, NOTCH1, ASB4, PPP1R12A and several other ARD-containing proteins. Also hydroxylates Asp and His residues within ARDs of ANK1 and TNKS2, respectively. Negatively regulates NOTCH1 activity, accelerating myogenic differentiation. Positively regulates ASB4 activity, promoting vascular differentiation. {ECO:0000269|PubMed:12042299, ECO:0000269|PubMed:12080085, ECO:0000269|PubMed:17003112, ECO:0000269|PubMed:17573339, ECO:0000269|PubMed:18299578, ECO:0000269|PubMed:19245366, ECO:0000269|PubMed:21177872, ECO:0000269|PubMed:21251231}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | EIF4A2 | chr3:186505373 | chr14:62213652 | ENST00000323963 | + | 9 | 11 | 64_235 | 333.0 | 408.0 | Domain | Helicase ATP-binding |
| Hgene | EIF4A2 | chr3:186505373 | chr14:62213652 | ENST00000440191 | + | 9 | 11 | 64_235 | 334.0 | 409.0 | Domain | Helicase ATP-binding |
| Hgene | EIF4A2 | chr3:186505373 | chr14:62213652 | ENST00000323963 | + | 9 | 11 | 183_186 | 333.0 | 408.0 | Motif | Note=DEAD box |
| Hgene | EIF4A2 | chr3:186505373 | chr14:62213652 | ENST00000323963 | + | 9 | 11 | 33_61 | 333.0 | 408.0 | Motif | Note=Q motif |
| Hgene | EIF4A2 | chr3:186505373 | chr14:62213652 | ENST00000440191 | + | 9 | 11 | 183_186 | 334.0 | 409.0 | Motif | Note=DEAD box |
| Hgene | EIF4A2 | chr3:186505373 | chr14:62213652 | ENST00000440191 | + | 9 | 11 | 33_61 | 334.0 | 409.0 | Motif | Note=Q motif |
| Hgene | EIF4A2 | chr3:186505373 | chr14:62213652 | ENST00000323963 | + | 9 | 11 | 77_84 | 333.0 | 408.0 | Nucleotide binding | ATP |
| Hgene | EIF4A2 | chr3:186505373 | chr14:62213652 | ENST00000440191 | + | 9 | 11 | 77_84 | 334.0 | 409.0 | Nucleotide binding | ATP |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000323441 | 12 | 14 | 786_826 | 734.0 | 736.0 | Region | Note=CTAD | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000337138 | 13 | 15 | 786_826 | 776.3333333333334 | 827.0 | Region | Note=CTAD |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | EIF4A2 | chr3:186505373 | chr14:62213652 | ENST00000323963 | + | 9 | 11 | 246_407 | 333.0 | 408.0 | Domain | Helicase C-terminal |
| Hgene | EIF4A2 | chr3:186505373 | chr14:62213652 | ENST00000440191 | + | 9 | 11 | 246_407 | 334.0 | 409.0 | Domain | Helicase C-terminal |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000323441 | 12 | 14 | 615_621 | 734.0 | 736.0 | Compositional bias | Note=Poly-Thr | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000337138 | 13 | 15 | 615_621 | 776.3333333333334 | 827.0 | Compositional bias | Note=Poly-Thr | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000539097 | 13 | 15 | 615_621 | 800.3333333333334 | 851.0 | Compositional bias | Note=Poly-Thr | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000323441 | 12 | 14 | 17_70 | 734.0 | 736.0 | Domain | bHLH | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000323441 | 12 | 14 | 228_298 | 734.0 | 736.0 | Domain | PAS 2 | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000323441 | 12 | 14 | 302_345 | 734.0 | 736.0 | Domain | Note=PAC | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000323441 | 12 | 14 | 85_158 | 734.0 | 736.0 | Domain | PAS 1 | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000337138 | 13 | 15 | 17_70 | 776.3333333333334 | 827.0 | Domain | bHLH | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000337138 | 13 | 15 | 228_298 | 776.3333333333334 | 827.0 | Domain | PAS 2 | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000337138 | 13 | 15 | 302_345 | 776.3333333333334 | 827.0 | Domain | Note=PAC | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000337138 | 13 | 15 | 85_158 | 776.3333333333334 | 827.0 | Domain | PAS 1 | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000539097 | 13 | 15 | 17_70 | 800.3333333333334 | 851.0 | Domain | bHLH | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000539097 | 13 | 15 | 228_298 | 800.3333333333334 | 851.0 | Domain | PAS 2 | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000539097 | 13 | 15 | 302_345 | 800.3333333333334 | 851.0 | Domain | Note=PAC | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000539097 | 13 | 15 | 85_158 | 800.3333333333334 | 851.0 | Domain | PAS 1 | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000323441 | 12 | 14 | 718_721 | 734.0 | 736.0 | Motif | Nuclear localization signal | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000337138 | 13 | 15 | 718_721 | 776.3333333333334 | 827.0 | Motif | Nuclear localization signal | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000539097 | 13 | 15 | 718_721 | 800.3333333333334 | 851.0 | Motif | Nuclear localization signal | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000323441 | 12 | 14 | 170_191 | 734.0 | 736.0 | Region | Required for heterodimer formation with ARNT | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000323441 | 12 | 14 | 21_30 | 734.0 | 736.0 | Region | DNA-binding | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000323441 | 12 | 14 | 380_417 | 734.0 | 736.0 | Region | Note=N-terminal VHL recognition site | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000323441 | 12 | 14 | 401_603 | 734.0 | 736.0 | Region | Note=ODD | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000323441 | 12 | 14 | 531_575 | 734.0 | 736.0 | Region | Note=NTAD | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000323441 | 12 | 14 | 556_572 | 734.0 | 736.0 | Region | Note=C-terminal VHL recognition site | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000323441 | 12 | 14 | 576_785 | 734.0 | 736.0 | Region | Note=ID | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000337138 | 13 | 15 | 170_191 | 776.3333333333334 | 827.0 | Region | Required for heterodimer formation with ARNT | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000337138 | 13 | 15 | 21_30 | 776.3333333333334 | 827.0 | Region | DNA-binding | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000337138 | 13 | 15 | 380_417 | 776.3333333333334 | 827.0 | Region | Note=N-terminal VHL recognition site | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000337138 | 13 | 15 | 401_603 | 776.3333333333334 | 827.0 | Region | Note=ODD | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000337138 | 13 | 15 | 531_575 | 776.3333333333334 | 827.0 | Region | Note=NTAD | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000337138 | 13 | 15 | 556_572 | 776.3333333333334 | 827.0 | Region | Note=C-terminal VHL recognition site | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000337138 | 13 | 15 | 576_785 | 776.3333333333334 | 827.0 | Region | Note=ID | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000539097 | 13 | 15 | 170_191 | 800.3333333333334 | 851.0 | Region | Required for heterodimer formation with ARNT | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000539097 | 13 | 15 | 21_30 | 800.3333333333334 | 851.0 | Region | DNA-binding | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000539097 | 13 | 15 | 380_417 | 800.3333333333334 | 851.0 | Region | Note=N-terminal VHL recognition site | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000539097 | 13 | 15 | 401_603 | 800.3333333333334 | 851.0 | Region | Note=ODD | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000539097 | 13 | 15 | 531_575 | 800.3333333333334 | 851.0 | Region | Note=NTAD | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000539097 | 13 | 15 | 556_572 | 800.3333333333334 | 851.0 | Region | Note=C-terminal VHL recognition site | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000539097 | 13 | 15 | 576_785 | 800.3333333333334 | 851.0 | Region | Note=ID | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000539097 | 13 | 15 | 786_826 | 800.3333333333334 | 851.0 | Region | Note=CTAD |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| EIF4A2 | |
| HIF1A |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000323441 | 12 | 14 | 1_401 | 734.0 | 736.0 | TSGA10 | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000337138 | 13 | 15 | 1_401 | 776.3333333333334 | 827.0 | TSGA10 | |
| Tgene | HIF1A | chr3:186505373 | chr14:62213652 | ENST00000539097 | 13 | 15 | 1_401 | 800.3333333333334 | 851.0 | TSGA10 |
Top |
Related Drugs to EIF4A2-HIF1A |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to EIF4A2-HIF1A |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies