| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:FHIT-HMGA2 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: FHIT-HMGA2 | FusionPDB ID: 30354 | FusionGDB2.0 ID: 30354 | Hgene | Tgene | Gene symbol | FHIT | HMGA2 | Gene ID | 2272 | 8091 |
| Gene name | fragile histidine triad diadenosine triphosphatase | high mobility group AT-hook 2 | |
| Synonyms | AP3Aase|FRA3B | BABL|HMGI-C|HMGIC|LIPO|STQTL9 | |
| Cytomap | 3p14.2 | 12q14.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | bis(5'-adenosyl)-triphosphataseAP3A hydrolasediadenosine 5',5'''-P1,P3-triphosphate hydrolasedinucleosidetriphosphatase | high mobility group protein HMGI-CHMGA2/KRT121P fusionhigh-mobility group (nonhistone chromosomal) protein isoform I-C | |
| Modification date | 20200313 | 20200329 | |
| UniProtAcc | P49789 | P52926 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000476844, ENST00000492590, ENST00000341848, ENST00000466788, ENST00000468189, | ENST00000393577, ENST00000403681, ENST00000541363, ENST00000354636, ENST00000536545, ENST00000393578, ENST00000425208, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 26 X 19 X 9=4446 | 16 X 12 X 5=960 |
| # samples | 26 | 15 | |
| ** MAII score | log2(26/4446*10)=-4.09592441999854 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(15/960*10)=-2.67807190511264 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: FHIT [Title/Abstract] AND HMGA2 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | |||
| Anticipated loss of major functional domain due to fusion event. | FHIT-HMGA2 seems lost the major protein functional domain in Hgene partner, which is a cell metabolism gene due to the frame-shifted ORF. FHIT-HMGA2 seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. FHIT-HMGA2 seems lost the major protein functional domain in Hgene partner, which is a tumor suppressor due to the frame-shifted ORF. FHIT-HMGA2 seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. FHIT-HMGA2 seems lost the major protein functional domain in Tgene partner, which is a transcription factor due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | FHIT | GO:0006163 | purine nucleotide metabolic process | 9323207 |
| Tgene | HMGA2 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 14627817 |
| Tgene | HMGA2 | GO:0002062 | chondrocyte differentiation | 21484705 |
| Tgene | HMGA2 | GO:0006284 | base-excision repair | 19465398 |
| Tgene | HMGA2 | GO:0007095 | mitotic G2 DNA damage checkpoint | 16061642 |
| Tgene | HMGA2 | GO:0010564 | regulation of cell cycle process | 14645522 |
| Tgene | HMGA2 | GO:0010628 | positive regulation of gene expression | 18832382 |
| Tgene | HMGA2 | GO:0031052 | chromosome breakage | 19549901 |
| Tgene | HMGA2 | GO:0031507 | heterochromatin assembly | 16901784 |
| Tgene | HMGA2 | GO:0035978 | histone H2A-S139 phosphorylation | 16061642 |
| Tgene | HMGA2 | GO:0035986 | senescence-associated heterochromatin focus assembly | 16901784 |
| Tgene | HMGA2 | GO:0035988 | chondrocyte proliferation | 21484705 |
| Tgene | HMGA2 | GO:0042769 | DNA damage response, detection of DNA damage | 19465398 |
| Tgene | HMGA2 | GO:0043065 | positive regulation of apoptotic process | 16061642 |
| Tgene | HMGA2 | GO:0043066 | negative regulation of apoptotic process | 19465398 |
| Tgene | HMGA2 | GO:0043392 | negative regulation of DNA binding | 14645522 |
| Tgene | HMGA2 | GO:0043922 | negative regulation by host of viral transcription | 17005673 |
| Tgene | HMGA2 | GO:0045869 | negative regulation of single stranded viral RNA replication via double stranded DNA intermediate | 17005673 |
| Tgene | HMGA2 | GO:0045892 | negative regulation of transcription, DNA-templated | 18832382 |
| Tgene | HMGA2 | GO:0045893 | positive regulation of transcription, DNA-templated | 15225648|15755872|17005673|17324944|17426251 |
| Tgene | HMGA2 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 14645522|18832382 |
| Tgene | HMGA2 | GO:0071158 | positive regulation of cell cycle arrest | 16061642 |
| Tgene | HMGA2 | GO:0071902 | positive regulation of protein serine/threonine kinase activity | 19549901 |
| Tgene | HMGA2 | GO:0090402 | oncogene-induced cell senescence | 16901784 |
| Tgene | HMGA2 | GO:2000648 | positive regulation of stem cell proliferation | 21484705 |
| Tgene | HMGA2 | GO:2000679 | positive regulation of transcription regulatory region DNA binding | 18832382 |
| Tgene | HMGA2 | GO:2000685 | positive regulation of cellular response to X-ray | 16061642 |
| Tgene | HMGA2 | GO:2001022 | positive regulation of response to DNA damage stimulus | 16061642|19465398 |
| Tgene | HMGA2 | GO:2001033 | negative regulation of double-strand break repair via nonhomologous end joining | 19549901 |
| Tgene | HMGA2 | GO:2001038 | regulation of cellular response to drug | 16061642 |
| Fusion gene breakpoints across FHIT (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
| Fusion gene breakpoints across HMGA2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerKB3 | . | . | FHIT | chr3 | 59737946 | - | HMGA2 | chr12 | 66308838 | + |
| ChimerKB3 | . | . | FHIT | chr3 | 59737946 | - | HMGA2 | chr12 | 66345162 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000341848 | FHIT | chr3 | 59737946 | - | ENST00000403681 | HMGA2 | chr12 | 66345162 | + | 3528 | 444 | 0 | 443 | 147 |
| ENST00000341848 | FHIT | chr3 | 59737946 | - | ENST00000393577 | HMGA2 | chr12 | 66345162 | + | 658 | 444 | 0 | 443 | 147 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >30354_30354_1_FHIT-HMGA2_FHIT_chr3_59737946_ENST00000341848_HMGA2_chr12_66345162_ENST00000393577_length(amino acids)=147AA_BP= MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQ -------------------------------------------------------------- >30354_30354_2_FHIT-HMGA2_FHIT_chr3_59737946_ENST00000341848_HMGA2_chr12_66345162_ENST00000403681_length(amino acids)=147AA_BP= MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQ -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr3:/chr12:) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| FHIT | HMGA2 |
| FUNCTION: Possesses dinucleoside triphosphate hydrolase activity (PubMed:12574506, PubMed:15182206, PubMed:8794732, PubMed:9323207, PubMed:9576908, PubMed:9543008). Cleaves P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP (PubMed:12574506, PubMed:15182206, PubMed:8794732, PubMed:9323207, PubMed:9576908, PubMed:9543008). Can also hydrolyze P(1)-P(4)-bis(5'-adenosyl) tetraphosphate (Ap4A), but has extremely low activity with ATP (PubMed:8794732). Exhibits adenylylsulfatase activity, hydrolyzing adenosine 5'-phosphosulfate to yield AMP and sulfate (PubMed:18694747). Exhibits adenosine 5'-monophosphoramidase activity, hydrolyzing purine nucleotide phosphoramidates with a single phosphate group such as adenosine 5'monophosphoramidate (AMP-NH2) to yield AMP and NH2 (PubMed:18694747). Exhibits adenylylsulfate-ammonia adenylyltransferase, catalyzing the ammonolysis of adenosine 5'-phosphosulfate resulting in the formation of adenosine 5'-phosphoramidate (PubMed:26181368). Also catalyzes the ammonolysis of adenosine 5-phosphorofluoridate and diadenosine triphosphate (PubMed:26181368). Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5 (PubMed:18077326). Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways (PubMed:16407838). Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis (PubMed:15313915). Induction of apoptosis depends on the ability of FHIT to bind P(1)-P(3)-bis(5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity, it may in part come from the mitochondrial form, which sensitizes the low-affinity Ca(2+) transporters, enhancing mitochondrial calcium uptake (PubMed:12574506, PubMed:19622739). Functions as tumor suppressor (By similarity). {ECO:0000250|UniProtKB:O89106, ECO:0000269|PubMed:12574506, ECO:0000269|PubMed:15313915, ECO:0000269|PubMed:16407838, ECO:0000269|PubMed:18077326, ECO:0000269|PubMed:18694747, ECO:0000269|PubMed:19622739, ECO:0000269|PubMed:26181368, ECO:0000269|PubMed:8794732, ECO:0000269|PubMed:9323207, ECO:0000269|PubMed:9543008}. | FUNCTION: Functions as a transcriptional regulator. Functions in cell cycle regulation through CCNA2. Plays an important role in chromosome condensation during the meiotic G2/M transition of spermatocytes. Plays a role in postnatal myogenesis, is involved in satellite cell activation (By similarity). Positively regulates IGF2 expression through PLAG1 and in a PLAG1-independent manner (PubMed:28796236). {ECO:0000250|UniProtKB:P52927, ECO:0000269|PubMed:14645522, ECO:0000269|PubMed:28796236}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Top |
Fusion Protein Structures |
| PDB and CIF files of the predicted fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| Fusion protein PDB link (fusion AA seq ID in FusionPDB) | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | AA seq | Len(AA seq) |
| PDB file (9) >>>9.pdbFusion protein BP residue: CIF file (9) >>>9.cif | FHIT | chr3 | 59737946 | - | HMGA2 | chr12 | 66345162 | + | MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDL RPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVL | 147 |
| 3D view using mol* of 9 (AA BP:) | ||||||||||
 | ||||||||||
Top |
pLDDT score distribution |
| pLDDT score distribution of the predicted wild-type structures of two partner proteins from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
FHIT_pLDDT.png  |
HMGA2_pLDDT.png  |
| pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
FHIT_HMGA2_9_pLDDT.png (AA BP:) |
FHIT_HMGA2_9_pLDDT_and_active_sites.png (AA BP:) |
FHIT_HMGA2_9_violinplot.png (AA BP:) |
Top |
Ramachandran Plot of Fusion Protein Structure |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| Fusion AA seq ID in FusionPDB and their Ramachandran plots |
| FHIT_HMGA2_9.png |
 |
Top |
Potential Active Site Information |
| The potential binding sites of these fusion proteins were identified using SiteMap, a module of the Schrodinger suite. |
| Fusion AA seq ID in FusionPDB | Site score | Size | D score | Volume | Exposure | Enclosure | Contact | Phobic | Philic | Balance | Don/Acc | Residues |
| 9 | 1.036 | 131 | 1.058 | 336.826 | 0.482 | 0.738 | 0.978 | 0.913 | 0.997 | 0.915 | 0.557 | Chain A: 5,8,9,10,11,13,14,25,26,27,28,29,37,83,90 ,91,92,96,98,120,121,124,129,130,131,132,135 |
Top |
Potentially Interacting Small Molecules through Virtual Screening |
| The FDA-approved small molecule library molecules were subjected to virtual screening using the Glide. |
| Fusion AA seq ID in FusionPDB | ZINC ID | DrugBank ID | Drug name | Docking score | Glide gscore |
Top |
| Drug information from DrugBank of the top 20 interacting small molecules. |
| ZINC ID | DrugBank ID | Drug name | Drug type | SMILES | Drug group |
Top |
Biochemical Features of Small Molecules |
| ADME (Absorption, Distribution, Metabolism, and Excretion) of drugs using QikProp(v3.9) |
| ZINC ID | mol_MW | dipole | SASA | FOSA | FISA | PISA | WPSA | volume | donorHB | accptHB | IP | Human Oral Absorption | Percent Human Oral Absorption | Rule Of Five | Rule Of Three |
Top |
Drug Toxicity Information |
| Toxicity information of individual drugs using eToxPred |
| ZINC ID | Smile | Surface Accessibility | Toxicity |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| FHIT | FHIT, UBE2I, CTNNB1, LEF1, TRIM23, RAB40B, MDM2, REL, TP53, ARHGAP19, MTMR6, RABL2A, CHEK1, DDIT4L, SPERT, FDCSP, GAST, GGH, BCAS2, PRPF6, YTHDF1, Rbm14, |
| HMGA2 | RELA, NFKB1, PIAS3, RB1, PRMT6, NPM1, SMAD1, SMAD5, SMAD9, PRKCA, HDGF, PTBP1, APEX1, SYNCRIP, XRCC6, PSIP1, PA2G4, PCBP2, E4F1, OBSL1, HIST1H3A, CREB1, NFATC1, PCGF1, POU5F1, DLST, EZH2, SUZ12, MYC, TP53, MDM2, CSK, VRK1, HIST1H1B, PRKAG2, DUX4, DUX4L9, SYDE1, ARHGAP21, ARHGAP39, Plekhg5, ZNF263, MAFB, KAT2B, HIST1H2BG, LMNB1, NDUFAF7, CSNK2A1, LIG3, SUPT16H, VRK3, SP2, C1QBP, PARP2, TOP3A, CSNK2A2, XPC, RANBP17, PARP1, SUPV3L1, HIST2H2AC, HIST2H3PS2, KPNA4, USP7, |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| FHIT |  |
| HMGA2 |  |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to FHIT-HMGA2 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to FHIT-HMGA2 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Hgene | FHIT | C0024121 | Lung Neoplasms | 2 | CTD_human |
| Hgene | FHIT | C0025500 | Mesothelioma | 2 | CTD_human |
| Hgene | FHIT | C0242379 | Malignant neoplasm of lung | 2 | CTD_human |
| Hgene | FHIT | C0007097 | Carcinoma | 1 | CTD_human |
| Hgene | FHIT | C0007131 | Non-Small Cell Lung Carcinoma | 1 | CTD_human |
| Hgene | FHIT | C0013146 | Drug abuse | 1 | CTD_human |
| Hgene | FHIT | C0013170 | Drug habituation | 1 | CTD_human |
| Hgene | FHIT | C0013222 | Drug Use Disorders | 1 | CTD_human |
| Hgene | FHIT | C0023903 | Liver neoplasms | 1 | CTD_human |
| Hgene | FHIT | C0024623 | Malignant neoplasm of stomach | 1 | CTD_human |
| Hgene | FHIT | C0029231 | Organic Mental Disorders, Substance-Induced | 1 | CTD_human |
| Hgene | FHIT | C0033578 | Prostatic Neoplasms | 1 | CTD_human |
| Hgene | FHIT | C0038356 | Stomach Neoplasms | 1 | CTD_human |
| Hgene | FHIT | C0038580 | Substance Dependence | 1 | CTD_human |
| Hgene | FHIT | C0038586 | Substance Use Disorders | 1 | CTD_human |
| Hgene | FHIT | C0042076 | Urologic Neoplasms | 1 | CTD_human |
| Hgene | FHIT | C0205696 | Anaplastic carcinoma | 1 | CTD_human |
| Hgene | FHIT | C0205697 | Carcinoma, Spindle-Cell | 1 | CTD_human |
| Hgene | FHIT | C0205698 | Undifferentiated carcinoma | 1 | CTD_human |
| Hgene | FHIT | C0205699 | Carcinomatosis | 1 | CTD_human |
| Hgene | FHIT | C0236733 | Amphetamine-Related Disorders | 1 | CTD_human |
| Hgene | FHIT | C0236804 | Amphetamine Addiction | 1 | CTD_human |
| Hgene | FHIT | C0236807 | Amphetamine Abuse | 1 | CTD_human |
| Hgene | FHIT | C0236969 | Substance-Related Disorders | 1 | CTD_human |
| Hgene | FHIT | C0345904 | Malignant neoplasm of liver | 1 | CTD_human |
| Hgene | FHIT | C0376358 | Malignant neoplasm of prostate | 1 | CTD_human |
| Hgene | FHIT | C0740858 | Substance abuse problem | 1 | CTD_human |
| Hgene | FHIT | C0751571 | Cancer of Urinary Tract | 1 | CTD_human |
| Hgene | FHIT | C1510472 | Drug Dependence | 1 | CTD_human |
| Hgene | FHIT | C1708349 | Hereditary Diffuse Gastric Cancer | 1 | CTD_human |
| Hgene | FHIT | C4316881 | Prescription Drug Abuse | 1 | CTD_human |
| Tgene | HMGA2 | C1519176 | Salivary Gland Pleomorphic Adenoma | 2 | ORPHANET |
| Tgene | HMGA2 | C0005612 | Birth Weight | 1 | CTD_human |
| Tgene | HMGA2 | C0006826 | Malignant Neoplasms | 1 | CTD_human |
| Tgene | HMGA2 | C0027626 | Neoplasm Invasiveness | 1 | CTD_human |
| Tgene | HMGA2 | C0027651 | Neoplasms | 1 | CTD_human |
| Tgene | HMGA2 | C0086692 | Benign Neoplasm | 1 | CTD_human |
| Tgene | HMGA2 | C0175693 | Russell-Silver syndrome | 1 | GENOMICS_ENGLAND |
| Tgene | HMGA2 | C0473935 | Radiolabeled somatostatin analog study | 1 | GENOMICS_ENGLAND |
| Tgene | HMGA2 | C0796160 | MENTAL RETARDATION, X-LINKED, SNYDER-ROBINSON TYPE | 1 | GENOMICS_ENGLAND |
| Tgene | HMGA2 | C1096309 | Myolipoma | 1 | GENOMICS_ENGLAND |
| Tgene | HMGA2 | C4305140 | 12q14 microdeletion syndrome | 1 | ORPHANET |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies