UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:AHI1-RPL22 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: AHI1-RPL22 | FusionPDB ID: 3097 | FusionGDB2.0 ID: 3097 | Hgene | Tgene | Gene symbol | AHI1 | RPL22 | Gene ID | 54806 | 6146 |
Gene name | Abelson helper integration site 1 | ribosomal protein L22 | |
Synonyms | AHI-1|JBTS3|ORF1|dJ71N10.1 | EAP|HBP15|HBP15/L22|L22 | |
Cytomap | 6q23.3 | 1p36.31 | |
Type of gene | protein-coding | protein-coding | |
Description | jouberinabelson helper integration site 1 protein homologcontatins SH3 and WD40 domains | 60S ribosomal protein L22EBER-associated proteinEpstein-Barr virus small RNA-associated proteinEpstein-Barr-encoded RNA-associated proteinheparin-binding protein 15heparin-binding protein HBp15large ribosomal subunit protein eL22 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | Q8N157 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000327035, ENST00000367798, ENST00000367800, ENST00000457866, ENST00000488690, ENST00000417892, ENST00000528103, ENST00000531527, ENST00000534469, | ENST00000497965, ENST00000234875, ENST00000484532, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 10 X 11 X 6=660 | 11 X 8 X 6=528 |
# samples | 10 | 12 | |
** MAII score | log2(10/660*10)=-2.72246602447109 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(12/528*10)=-2.13750352374993 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: AHI1 [Title/Abstract] AND RPL22 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | AHI1(135811761)-RPL22(6257816), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | AHI1-RPL22 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. AHI1-RPL22 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. AHI1-RPL22 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. AHI1-RPL22 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. AHI1-RPL22 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. AHI1-RPL22 seems lost the major protein functional domain in Tgene partner, which is a cell metabolism gene due to the frame-shifted ORF. AHI1-RPL22 seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. AHI1-RPL22 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | STAD | TCGA-HU-A4HB-01A | AHI1 | chr6 | 135811761 | - | RPL22 | chr1 | 6257816 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000457866 | AHI1 | chr6 | 135811761 | - | ENST00000484532 | RPL22 | chr1 | 6257816 | - | 883 | 434 | 803 | 411 | 130 |
ENST00000457866 | AHI1 | chr6 | 135811761 | - | ENST00000234875 | RPL22 | chr1 | 6257816 | - | 2461 | 434 | 299 | 808 | 169 |
ENST00000327035 | AHI1 | chr6 | 135811761 | - | ENST00000484532 | RPL22 | chr1 | 6257816 | - | 863 | 414 | 783 | 391 | 130 |
ENST00000327035 | AHI1 | chr6 | 135811761 | - | ENST00000234875 | RPL22 | chr1 | 6257816 | - | 2441 | 414 | 279 | 788 | 169 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000457866 | ENST00000484532 | AHI1 | chr6 | 135811761 | - | RPL22 | chr1 | 6257816 | - | 0.12105141 | 0.87894857 |
ENST00000457866 | ENST00000234875 | AHI1 | chr6 | 135811761 | - | RPL22 | chr1 | 6257816 | - | 0.002537533 | 0.9974624 |
ENST00000327035 | ENST00000484532 | AHI1 | chr6 | 135811761 | - | RPL22 | chr1 | 6257816 | - | 0.14712591 | 0.85287404 |
ENST00000327035 | ENST00000234875 | AHI1 | chr6 | 135811761 | - | RPL22 | chr1 | 6257816 | - | 0.002223588 | 0.99777645 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >3097_3097_1_AHI1-RPL22_AHI1_chr6_135811761_ENST00000327035_RPL22_chr1_6257816_ENST00000234875_length(amino acids)=169AA_BP=45 MPTAESEAKVKTKVRFEELLKTHSDLMREKKKLKKKLVRSEENISKKLVVKGGKKKKQVLKFTLDCTHPVEDGIMDAANFEQFLQERIKV -------------------------------------------------------------- >3097_3097_2_AHI1-RPL22_AHI1_chr6_135811761_ENST00000327035_RPL22_chr1_6257816_ENST00000484532_length(amino acids)=130AA_BP=1 MHSSLGKERSVQPSGTKDWGVGNPSISQIRFNYAVDREAGSAQCWPPFGERHLGCHGDLALAPFDGHHPSTKVPSFSVHFDPFLQKLLKI -------------------------------------------------------------- >3097_3097_3_AHI1-RPL22_AHI1_chr6_135811761_ENST00000457866_RPL22_chr1_6257816_ENST00000234875_length(amino acids)=169AA_BP=45 MPTAESEAKVKTKVRFEELLKTHSDLMREKKKLKKKLVRSEENISKKLVVKGGKKKKQVLKFTLDCTHPVEDGIMDAANFEQFLQERIKV -------------------------------------------------------------- >3097_3097_4_AHI1-RPL22_AHI1_chr6_135811761_ENST00000457866_RPL22_chr1_6257816_ENST00000484532_length(amino acids)=130AA_BP=1 MHSSLGKERSVQPSGTKDWGVGNPSISQIRFNYAVDREAGSAQCWPPFGERHLGCHGDLALAPFDGHHPSTKVPSFSVHFDPFLQKLLKI -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr6:135811761/chr1:6257816) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
AHI1 | . |
FUNCTION: Involved in vesicle trafficking and required for ciliogenesis, formation of primary non-motile cilium, and recruitment of RAB8A to the basal body of primary cilium. Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Involved in neuronal differentiation. As a positive modulator of classical Wnt signaling, may play a crucial role in ciliary signaling during cerebellum embryonic development (PubMed:21623382). {ECO:0000250|UniProtKB:Q8K3E5, ECO:0000269|PubMed:21623382}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000327035 | - | 4 | 23 | 13_45 | 45.0 | 1054.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000367800 | - | 3 | 27 | 13_45 | 45.0 | 1197.0 | Coiled coil | Ontology_term=ECO:0000255 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000457866 | - | 4 | 28 | 13_45 | 45.0 | 1197.0 | Coiled coil | Ontology_term=ECO:0000255 |
Tgene | RPL22 | chr6:135811761 | chr1:6257816 | ENST00000234875 | 0 | 4 | 120_128 | 4.0 | 129.0 | Compositional bias | Note=Asp/Glu-rich (highly acidic) |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000327035 | - | 4 | 23 | 234_239 | 45.0 | 1054.0 | Compositional bias | Note=Poly-Lys |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000367800 | - | 3 | 27 | 234_239 | 45.0 | 1197.0 | Compositional bias | Note=Poly-Lys |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000457866 | - | 4 | 28 | 234_239 | 45.0 | 1197.0 | Compositional bias | Note=Poly-Lys |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000327035 | - | 4 | 23 | 1051_1111 | 45.0 | 1054.0 | Domain | SH3 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000367800 | - | 3 | 27 | 1051_1111 | 45.0 | 1197.0 | Domain | SH3 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000457866 | - | 4 | 28 | 1051_1111 | 45.0 | 1197.0 | Domain | SH3 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000327035 | - | 4 | 23 | 607_649 | 45.0 | 1054.0 | Repeat | Note=WD 1 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000327035 | - | 4 | 23 | 652_691 | 45.0 | 1054.0 | Repeat | Note=WD 2 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000327035 | - | 4 | 23 | 695_735 | 45.0 | 1054.0 | Repeat | Note=WD 3 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000327035 | - | 4 | 23 | 742_781 | 45.0 | 1054.0 | Repeat | Note=WD 4 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000327035 | - | 4 | 23 | 797_837 | 45.0 | 1054.0 | Repeat | Note=WD 5 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000327035 | - | 4 | 23 | 841_880 | 45.0 | 1054.0 | Repeat | Note=WD 6 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000327035 | - | 4 | 23 | 885_926 | 45.0 | 1054.0 | Repeat | Note=WD 7 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000367800 | - | 3 | 27 | 607_649 | 45.0 | 1197.0 | Repeat | Note=WD 1 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000367800 | - | 3 | 27 | 652_691 | 45.0 | 1197.0 | Repeat | Note=WD 2 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000367800 | - | 3 | 27 | 695_735 | 45.0 | 1197.0 | Repeat | Note=WD 3 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000367800 | - | 3 | 27 | 742_781 | 45.0 | 1197.0 | Repeat | Note=WD 4 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000367800 | - | 3 | 27 | 797_837 | 45.0 | 1197.0 | Repeat | Note=WD 5 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000367800 | - | 3 | 27 | 841_880 | 45.0 | 1197.0 | Repeat | Note=WD 6 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000367800 | - | 3 | 27 | 885_926 | 45.0 | 1197.0 | Repeat | Note=WD 7 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000457866 | - | 4 | 28 | 607_649 | 45.0 | 1197.0 | Repeat | Note=WD 1 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000457866 | - | 4 | 28 | 652_691 | 45.0 | 1197.0 | Repeat | Note=WD 2 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000457866 | - | 4 | 28 | 695_735 | 45.0 | 1197.0 | Repeat | Note=WD 3 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000457866 | - | 4 | 28 | 742_781 | 45.0 | 1197.0 | Repeat | Note=WD 4 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000457866 | - | 4 | 28 | 797_837 | 45.0 | 1197.0 | Repeat | Note=WD 5 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000457866 | - | 4 | 28 | 841_880 | 45.0 | 1197.0 | Repeat | Note=WD 6 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000457866 | - | 4 | 28 | 885_926 | 45.0 | 1197.0 | Repeat | Note=WD 7 |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
AHI1 | |
RPL22 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000327035 | - | 4 | 23 | 141_434 | 45.0 | 1054.0 | HAP1 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000367800 | - | 3 | 27 | 141_434 | 45.0 | 1197.0 | HAP1 |
Hgene | AHI1 | chr6:135811761 | chr1:6257816 | ENST00000457866 | - | 4 | 28 | 141_434 | 45.0 | 1197.0 | HAP1 |
Top |
Related Drugs to AHI1-RPL22 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to AHI1-RPL22 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |