UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:FZD6-DCAF13 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: FZD6-DCAF13 | FusionPDB ID: 31961 | FusionGDB2.0 ID: 31961 | Hgene | Tgene | Gene symbol | FZD6 | DCAF13 | Gene ID | 8323 | 25879 |
Gene name | frizzled class receptor 6 | DDB1 and CUL4 associated factor 13 | |
Synonyms | FZ-6|FZ6|HFZ6|NDNC1|NDNC10 | GM83|HSPC064|Sof1|WDSOF1 | |
Cytomap | 8q22.3 | 8q22.3 | |
Type of gene | protein-coding | protein-coding | |
Description | frizzled-6frizzled 6, seven transmembrane spanning receptorfrizzled family receptor 6frizzled homolog 6seven transmembrane helix receptor | DDB1- and CUL4-associated factor 13WD repeat and SOF domain-containing protein 1WD repeats and SOF1 domain containing | |
Modification date | 20200327 | 20200313 | |
UniProtAcc | O60353 | Q9NV06 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000358755, ENST00000522566, ENST00000523739, ENST00000540287, | ENST00000521999, ENST00000519682, ENST00000521716, ENST00000521971, ENST00000297579, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 8 X 4 X 6=192 | 7 X 7 X 4=196 |
# samples | 8 | 7 | |
** MAII score | log2(8/192*10)=-1.26303440583379 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(7/196*10)=-1.48542682717024 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: FZD6 [Title/Abstract] AND DCAF13 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | FZD6(104312512)-DCAF13(104447854), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | FZD6-DCAF13 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. FZD6-DCAF13 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. FZD6-DCAF13 seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. FZD6-DCAF13 seems lost the major protein functional domain in Tgene partner, which is a essential gene due to the frame-shifted ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | FZD6 | GO:0035567 | non-canonical Wnt signaling pathway | 14747478 |
Hgene | FZD6 | GO:0043433 | negative regulation of DNA-binding transcription factor activity | 14747478 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BLCA | TCGA-SY-A9G5-01A | FZD6 | chr8 | 104312512 | + | DCAF13 | chr8 | 104447854 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000540287 | FZD6 | chr8 | 104312512 | + | ENST00000297579 | DCAF13 | chr8 | 104447854 | + | 1573 | 449 | 417 | 1001 | 194 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000540287 | ENST00000297579 | FZD6 | chr8 | 104312512 | + | DCAF13 | chr8 | 104447854 | + | 0.001248622 | 0.9987514 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >31961_31961_1_FZD6-DCAF13_FZD6_chr8_104312512_ENST00000540287_DCAF13_chr8_104447854_ENST00000297579_length(amino acids)=194AA_BP=0 MTRVLPRWKWSLYTFDMRALDTPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYHTKRMQHVICVKWTSDSKYIM CGSDEMNIRLWKANASEKLGVLTSREKAAKDYNQKLKEKFQHYPHIKRIARHRHLPKSIYSQIQEQRIMKEARRRKEVNRIKHSKPGSVP -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr8:104312512/chr8:104447854) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
FZD6 | DCAF13 |
FUNCTION: Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Together with FZD3, is involved in the neural tube closure and plays a role in the regulation of the establishment of planar cell polarity (PCP), particularly in the orientation of asymmetric bundles of stereocilia on the apical faces of a subset of auditory and vestibular sensory cells located in the inner ear (By similarity). {ECO:0000250|UniProtKB:Q61089}. | FUNCTION: Possible role in ribosomal RNA processing (By similarity). May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. {ECO:0000250, ECO:0000269|PubMed:16949367}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 19_132 | 59.0 | 707.0 | Domain | FZ |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 19_132 | 59.0 | 707.0 | Domain | FZ |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 19_132 | 27.0 | 675.0 | Domain | FZ |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 19_201 | 59.0 | 707.0 | Topological domain | Extracellular |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 223_233 | 59.0 | 707.0 | Topological domain | Cytoplasmic |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 255_284 | 59.0 | 707.0 | Topological domain | Extracellular |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 306_324 | 59.0 | 707.0 | Topological domain | Cytoplasmic |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 346_370 | 59.0 | 707.0 | Topological domain | Extracellular |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 392_416 | 59.0 | 707.0 | Topological domain | Cytoplasmic |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 438_473 | 59.0 | 707.0 | Topological domain | Extracellular |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 495_706 | 59.0 | 707.0 | Topological domain | Cytoplasmic |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 19_201 | 59.0 | 707.0 | Topological domain | Extracellular |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 223_233 | 59.0 | 707.0 | Topological domain | Cytoplasmic |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 255_284 | 59.0 | 707.0 | Topological domain | Extracellular |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 306_324 | 59.0 | 707.0 | Topological domain | Cytoplasmic |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 346_370 | 59.0 | 707.0 | Topological domain | Extracellular |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 392_416 | 59.0 | 707.0 | Topological domain | Cytoplasmic |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 438_473 | 59.0 | 707.0 | Topological domain | Extracellular |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 495_706 | 59.0 | 707.0 | Topological domain | Cytoplasmic |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 19_201 | 27.0 | 675.0 | Topological domain | Extracellular |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 223_233 | 27.0 | 675.0 | Topological domain | Cytoplasmic |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 255_284 | 27.0 | 675.0 | Topological domain | Extracellular |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 306_324 | 27.0 | 675.0 | Topological domain | Cytoplasmic |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 346_370 | 27.0 | 675.0 | Topological domain | Extracellular |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 392_416 | 27.0 | 675.0 | Topological domain | Cytoplasmic |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 438_473 | 27.0 | 675.0 | Topological domain | Extracellular |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 495_706 | 27.0 | 675.0 | Topological domain | Cytoplasmic |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 202_222 | 59.0 | 707.0 | Transmembrane | Helical%3B Name%3D1 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 234_254 | 59.0 | 707.0 | Transmembrane | Helical%3B Name%3D2 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 285_305 | 59.0 | 707.0 | Transmembrane | Helical%3B Name%3D3 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 325_345 | 59.0 | 707.0 | Transmembrane | Helical%3B Name%3D4 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 371_391 | 59.0 | 707.0 | Transmembrane | Helical%3B Name%3D5 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 417_437 | 59.0 | 707.0 | Transmembrane | Helical%3B Name%3D6 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000358755 | + | 2 | 7 | 474_494 | 59.0 | 707.0 | Transmembrane | Helical%3B Name%3D7 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 202_222 | 59.0 | 707.0 | Transmembrane | Helical%3B Name%3D1 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 234_254 | 59.0 | 707.0 | Transmembrane | Helical%3B Name%3D2 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 285_305 | 59.0 | 707.0 | Transmembrane | Helical%3B Name%3D3 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 325_345 | 59.0 | 707.0 | Transmembrane | Helical%3B Name%3D4 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 371_391 | 59.0 | 707.0 | Transmembrane | Helical%3B Name%3D5 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 417_437 | 59.0 | 707.0 | Transmembrane | Helical%3B Name%3D6 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000522566 | + | 2 | 7 | 474_494 | 59.0 | 707.0 | Transmembrane | Helical%3B Name%3D7 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 202_222 | 27.0 | 675.0 | Transmembrane | Helical%3B Name%3D1 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 234_254 | 27.0 | 675.0 | Transmembrane | Helical%3B Name%3D2 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 285_305 | 27.0 | 675.0 | Transmembrane | Helical%3B Name%3D3 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 325_345 | 27.0 | 675.0 | Transmembrane | Helical%3B Name%3D4 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 371_391 | 27.0 | 675.0 | Transmembrane | Helical%3B Name%3D5 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 417_437 | 27.0 | 675.0 | Transmembrane | Helical%3B Name%3D6 |
Hgene | FZD6 | chr8:104312512 | chr8:104447854 | ENST00000523739 | + | 3 | 8 | 474_494 | 27.0 | 675.0 | Transmembrane | Helical%3B Name%3D7 |
Tgene | DCAF13 | chr8:104312512 | chr8:104447854 | ENST00000297579 | 6 | 11 | 107_146 | 413.6666666666667 | 598.0 | Repeat | Note=WD 2 | |
Tgene | DCAF13 | chr8:104312512 | chr8:104447854 | ENST00000297579 | 6 | 11 | 149_191 | 413.6666666666667 | 598.0 | Repeat | Note=WD 3 | |
Tgene | DCAF13 | chr8:104312512 | chr8:104447854 | ENST00000297579 | 6 | 11 | 194_234 | 413.6666666666667 | 598.0 | Repeat | Note=WD 4 | |
Tgene | DCAF13 | chr8:104312512 | chr8:104447854 | ENST00000297579 | 6 | 11 | 236_276 | 413.6666666666667 | 598.0 | Repeat | Note=WD 5 | |
Tgene | DCAF13 | chr8:104312512 | chr8:104447854 | ENST00000297579 | 6 | 11 | 280_319 | 413.6666666666667 | 598.0 | Repeat | Note=WD 6 | |
Tgene | DCAF13 | chr8:104312512 | chr8:104447854 | ENST00000297579 | 6 | 11 | 323_362 | 413.6666666666667 | 598.0 | Repeat | Note=WD 7 | |
Tgene | DCAF13 | chr8:104312512 | chr8:104447854 | ENST00000297579 | 6 | 11 | 64_104 | 413.6666666666667 | 598.0 | Repeat | Note=WD 1 |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
FZD6 | |
DCAF13 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to FZD6-DCAF13 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to FZD6-DCAF13 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |