| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:AKAP8-BRD4 |
Fusion Protein Summary |
Fusion gene summary |
| Fusion partner gene information | Fusion gene name: AKAP8-BRD4 | FusionPDB ID: 3365 | FusionGDB2.0 ID: 3365 | Hgene | Tgene | Gene symbol | AKAP8 | BRD4 | Gene ID | 10270 | 23476 |
| Gene name | A-kinase anchoring protein 8 | bromodomain containing 4 | |
| Synonyms | AKAP 95|AKAP-8|AKAP-95|AKAP95 | CAP|HUNK1|HUNKI|MCAP | |
| Cytomap | 19p13.12 | 19p13.12 | |
| Type of gene | protein-coding | protein-coding | |
| Description | A-kinase anchor protein 8A kinase (PRKA) anchor protein 8A-kinase anchor protein, 95kDa | bromodomain-containing protein 4chromosome-associated proteinmitotic chromosome-associated protein | |
| Modification date | 20200313 | 20200329 | |
| UniProtAcc | Q9ULX6 | O60885 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000269701, | ENST00000602230, ENST00000263377, ENST00000360016, ENST00000371835, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 13 X 14 X 9=1638 | 15 X 19 X 13=3705 |
| # samples | 17 | 28 | |
| ** MAII score | log2(17/1638*10)=-3.26832870550331 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(28/3705*10)=-3.72597481024823 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: AKAP8 [Title/Abstract] AND BRD4 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | AKAP8(15465385)-BRD4(15359824), # samples:1 AKAP8(15487787)-BRD4(15367984), # samples:1 AKAP8(15490524)-BRD4(15367984), # samples:1 AKAP8(15487787)-BRD4(15366403), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | AKAP8-BRD4 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. AKAP8-BRD4 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. AKAP8-BRD4 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. AKAP8-BRD4 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. AKAP8-BRD4 seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF. AKAP8-BRD4 seems lost the major protein functional domain in Hgene partner, which is a transcription factor due to the frame-shifted ORF. AKAP8-BRD4 seems lost the major protein functional domain in Tgene partner, which is a CGC due to the frame-shifted ORF. AKAP8-BRD4 seems lost the major protein functional domain in Tgene partner, which is a epigenetic factor due to the frame-shifted ORF. AKAP8-BRD4 seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. AKAP8-BRD4 seems lost the major protein functional domain in Tgene partner, which is a kinase due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | BRD4 | GO:0032968 | positive regulation of transcription elongation from RNA polymerase II promoter | 19103749|23086925 |
| Tgene | BRD4 | GO:0043123 | positive regulation of I-kappaB kinase/NF-kappaB signaling | 19103749 |
| Tgene | BRD4 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 23086925|23317504|24360279 |
| Tgene | BRD4 | GO:0050727 | regulation of inflammatory response | 19103749 |
| Tgene | BRD4 | GO:1901407 | regulation of phosphorylation of RNA polymerase II C-terminal domain | 23086925 |
Fusion gene breakpoints across AKAP8 (5'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Fusion gene breakpoints across BRD4 (3'-gene)* Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0)* All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | BLCA | TCGA-GV-A3QI-01A | AKAP8 | chr19 | 15465385 | - | BRD4 | chr19 | 15359824 | - |
| ChimerDB4 | BLCA | TCGA-ZF-AA4V-01A | AKAP8 | chr19 | 15487787 | - | BRD4 | chr19 | 15367984 | - |
| ChimerDB4 | BLCA | TCGA-ZF-AA4V-01A | AKAP8 | chr19 | 15490524 | - | BRD4 | chr19 | 15367984 | - |
| ChimerDB4 | OV | TCGA-04-1338-01A | AKAP8 | chr19 | 15487787 | - | BRD4 | chr19 | 15366403 | - |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000269701 | AKAP8 | chr19 | 15490524 | - | ENST00000263377 | BRD4 | chr19 | 15367984 | - | 4369 | 80 | 14 | 2827 | 937 |
| ENST00000269701 | AKAP8 | chr19 | 15490524 | - | ENST00000371835 | BRD4 | chr19 | 15367984 | - | 3131 | 80 | 14 | 907 | 297 |
| ENST00000269701 | AKAP8 | chr19 | 15490524 | - | ENST00000360016 | BRD4 | chr19 | 15367984 | - | 1689 | 80 | 14 | 1123 | 369 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000269701 | ENST00000263377 | AKAP8 | chr19 | 15490524 | - | BRD4 | chr19 | 15367984 | - | 0.010930412 | 0.98906964 |
| ENST00000269701 | ENST00000371835 | AKAP8 | chr19 | 15490524 | - | BRD4 | chr19 | 15367984 | - | 0.00372581 | 0.99627423 |
| ENST00000269701 | ENST00000360016 | AKAP8 | chr19 | 15490524 | - | BRD4 | chr19 | 15367984 | - | 0.007903014 | 0.992097 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >3365_3365_1_AKAP8-BRD4_AKAP8_chr19_15490524_ENST00000269701_BRD4_chr19_15367984_ENST00000263377_length(amino acids)=937AA_BP=547 MWSPSKRGCWWAASKTWTRATEDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQ EQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYESEEED KCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKM KGFSSSESESSSESSSSDSEDSETEMAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPPPPPSM PQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSN RAAALPPKPARPPAVSPALTQTPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPS VQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPPHPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYS TGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVH LPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKE EREKALKAQAEHAEKEKERLRQERMRSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQR -------------------------------------------------------------- >3365_3365_2_AKAP8-BRD4_AKAP8_chr19_15490524_ENST00000269701_BRD4_chr19_15367984_ENST00000360016_length(amino acids)=369AA_BP=1 MWSPSKRGCWWAASKTWTRATEDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQ EQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYESEEED KCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKM KGFSSSESESSSESSSSDSEDSETAFCTSGDFVSPGPSPYHSHVQCGRFREMLRWFLVDVEQTAAGQPHRQSAAGPAITWAPAIAYPSPE -------------------------------------------------------------- >3365_3365_3_AKAP8-BRD4_AKAP8_chr19_15490524_ENST00000269701_BRD4_chr19_15367984_ENST00000371835_length(amino acids)=297AA_BP=1 MWSPSKRGCWWAASKTWTRATEDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQ EQLKAVHEQLAALSQPQQNKPKKKEKDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYESEEED KCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKM -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genesGo to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:15465385/chr19:15359824) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| AKAP8 | BRD4 |
| FUNCTION: Could play a role in constitutive transport element (CTE)-mediated gene expression by association with DHX9. Increases CTE-dependent nuclear unspliced mRNA export (PubMed:10748171, PubMed:11402034). Proposed to target PRKACA to the nucleus but does not seem to be implicated in the binding of regulatory subunit II of PKA (PubMed:10761695, PubMed:11884601). May be involved in nuclear envelope breakdown and chromatin condensation. May be involved in anchoring nuclear membranes to chromatin in interphase and in releasing membranes from chromating at mitosis (PubMed:11034899). May regulate the initiation phase of DNA replication when associated with TMPO isoform Beta (PubMed:12538639). Required for cell cycle G2/M transition and histone deacetylation during mitosis. In mitotic cells recruits HDAC3 to the vicinity of chromatin leading to deacetylation and subsequent phosphorylation at 'Ser-10' of histone H3; in this function seems to act redundantly with AKAP8 (PubMed:16980585). May be involved in regulation of pre-mRNA splicing (PubMed:17594903). {ECO:0000269|PubMed:10748171, ECO:0000269|PubMed:11034899, ECO:0000269|PubMed:11402034, ECO:0000269|PubMed:11884601, ECO:0000269|PubMed:12538639, ECO:0000269|PubMed:16980585, ECO:0000305|PubMed:10761695}.; FUNCTION: (Microbial infection) In case of EBV infection, may target PRKACA to EBNA-LP-containing nuclear sites to modulate transcription from specific promoters. {ECO:0000269|PubMed:11884601}.; FUNCTION: (Microbial infection) Can synergize with DHX9 to activate the CTE-mediated gene expression of type D retroviruses. {ECO:0000269|PubMed:11402034}.; FUNCTION: (Microbial infection) In case of HIV-1 infection, involved in the DHX9-promoted annealing of host tRNA(Lys3) to viral genomic RNA as a primer in reverse transcription; in vitro negatively regulates DHX9 annealing activity. {ECO:0000269|PubMed:25034436}. | FUNCTION: Chromatin reader protein that recognizes and binds acetylated histones and plays a key role in transmission of epigenetic memory across cell divisions and transcription regulation. Remains associated with acetylated chromatin throughout the entire cell cycle and provides epigenetic memory for postmitotic G1 gene transcription by preserving acetylated chromatin status and maintaining high-order chromatin structure (PubMed:23589332, PubMed:23317504, PubMed:22334664). During interphase, plays a key role in regulating the transcription of signal-inducible genes by associating with the P-TEFb complex and recruiting it to promoters. Also recruits P-TEFb complex to distal enhancers, so called anti-pause enhancers in collaboration with JMJD6. BRD4 and JMJD6 are required to form the transcriptionally active P-TEFb complex by displacing negative regulators such as HEXIM1 and 7SKsnRNA complex from P-TEFb, thereby transforming it into an active form that can then phosphorylate the C-terminal domain (CTD) of RNA polymerase II (PubMed:23589332, PubMed:19596240, PubMed:16109377, PubMed:16109376, PubMed:24360279). Promotes phosphorylation of 'Ser-2' of the C-terminal domain (CTD) of RNA polymerase II (PubMed:23086925). According to a report, directly acts as an atypical protein kinase and mediates phosphorylation of 'Ser-2' of the C-terminal domain (CTD) of RNA polymerase II; these data however need additional evidences in vivo (PubMed:22509028). In addition to acetylated histones, also recognizes and binds acetylated RELA, leading to further recruitment of the P-TEFb complex and subsequent activation of NF-kappa-B (PubMed:19103749). Also acts as a regulator of p53/TP53-mediated transcription: following phosphorylation by CK2, recruited to p53/TP53 specific target promoters (PubMed:23317504). {ECO:0000269|PubMed:16109376, ECO:0000269|PubMed:16109377, ECO:0000269|PubMed:19103749, ECO:0000269|PubMed:19596240, ECO:0000269|PubMed:22334664, ECO:0000269|PubMed:22509028, ECO:0000269|PubMed:23086925, ECO:0000269|PubMed:23317504, ECO:0000269|PubMed:23589332, ECO:0000269|PubMed:24360279}.; FUNCTION: [Isoform B]: Acts as a chromatin insulator in the DNA damage response pathway. Inhibits DNA damage response signaling by recruiting the condensin-2 complex to acetylated histones, leading to chromatin structure remodeling, insulating the region from DNA damage response by limiting spreading of histone H2AX/H2A.x phosphorylation. {ECO:0000269|PubMed:23728299}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 1011_1014 | 447.0 | 1363.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 1028_1033 | 447.0 | 1363.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 1283_1300 | 447.0 | 1363.0 | Compositional bias | Note=Poly-Gln | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 1301_1308 | 447.0 | 1363.0 | Compositional bias | Note=Poly-Ala | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 1335_1338 | 447.0 | 1363.0 | Compositional bias | Note=Poly-Arg | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 535_594 | 447.0 | 1363.0 | Compositional bias | Note=Lys-rich | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 692_717 | 447.0 | 1363.0 | Compositional bias | Note=Ser-rich | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 703_714 | 447.0 | 1363.0 | Compositional bias | Note=Poly-Ser | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 738_743 | 447.0 | 1363.0 | Compositional bias | Note=Poly-His | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 757_761 | 447.0 | 1363.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 764_770 | 447.0 | 1363.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 771_775 | 447.0 | 1363.0 | Compositional bias | Note=Poly-Gln | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 776_783 | 447.0 | 1363.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 954_964 | 447.0 | 1363.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 974_986 | 447.0 | 1363.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 1011_1014 | 447.0 | 795.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 1028_1033 | 447.0 | 795.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 1283_1300 | 447.0 | 795.0 | Compositional bias | Note=Poly-Gln | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 1301_1308 | 447.0 | 795.0 | Compositional bias | Note=Poly-Ala | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 1335_1338 | 447.0 | 795.0 | Compositional bias | Note=Poly-Arg | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 535_594 | 447.0 | 795.0 | Compositional bias | Note=Lys-rich | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 692_717 | 447.0 | 795.0 | Compositional bias | Note=Ser-rich | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 703_714 | 447.0 | 795.0 | Compositional bias | Note=Poly-Ser | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 738_743 | 447.0 | 795.0 | Compositional bias | Note=Poly-His | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 757_761 | 447.0 | 795.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 764_770 | 447.0 | 795.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 771_775 | 447.0 | 795.0 | Compositional bias | Note=Poly-Gln | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 776_783 | 447.0 | 795.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 954_964 | 447.0 | 795.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 974_986 | 447.0 | 795.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 1011_1014 | 447.0 | 723.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 1028_1033 | 447.0 | 723.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 1283_1300 | 447.0 | 723.0 | Compositional bias | Note=Poly-Gln | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 1301_1308 | 447.0 | 723.0 | Compositional bias | Note=Poly-Ala | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 1335_1338 | 447.0 | 723.0 | Compositional bias | Note=Poly-Arg | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 535_594 | 447.0 | 723.0 | Compositional bias | Note=Lys-rich | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 692_717 | 447.0 | 723.0 | Compositional bias | Note=Ser-rich | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 703_714 | 447.0 | 723.0 | Compositional bias | Note=Poly-Ser | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 738_743 | 447.0 | 723.0 | Compositional bias | Note=Poly-His | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 757_761 | 447.0 | 723.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 764_770 | 447.0 | 723.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 771_775 | 447.0 | 723.0 | Compositional bias | Note=Poly-Gln | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 776_783 | 447.0 | 723.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 954_964 | 447.0 | 723.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 974_986 | 447.0 | 723.0 | Compositional bias | Note=Poly-Pro | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 600_682 | 447.0 | 1363.0 | Domain | NET | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 600_682 | 447.0 | 795.0 | Domain | NET | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 600_682 | 447.0 | 723.0 | Domain | NET | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 1047_1362 | 447.0 | 1363.0 | Region | Note=C-terminal (CTD) region | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 484_503 | 447.0 | 1363.0 | Region | Note=NPS region | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 524_579 | 447.0 | 1363.0 | Region | Note=BID region | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 1047_1362 | 447.0 | 795.0 | Region | Note=C-terminal (CTD) region | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 484_503 | 447.0 | 795.0 | Region | Note=NPS region | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 524_579 | 447.0 | 795.0 | Region | Note=BID region | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 1047_1362 | 447.0 | 723.0 | Region | Note=C-terminal (CTD) region | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 484_503 | 447.0 | 723.0 | Region | Note=NPS region | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 524_579 | 447.0 | 723.0 | Region | Note=BID region |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | AKAP8 | chr19:15490524 | chr19:15367984 | ENST00000269701 | - | 1 | 14 | 107_118 | 6.333333333333333 | 693.0 | Compositional bias | Note=Poly-Gly |
| Hgene | AKAP8 | chr19:15490524 | chr19:15367984 | ENST00000269701 | - | 1 | 14 | 289_306 | 6.333333333333333 | 693.0 | Motif | Bipartite nuclear localization signal |
| Hgene | AKAP8 | chr19:15490524 | chr19:15367984 | ENST00000269701 | - | 1 | 14 | 387_450 | 6.333333333333333 | 693.0 | Region | Involved in chromatin-binding |
| Hgene | AKAP8 | chr19:15490524 | chr19:15367984 | ENST00000269701 | - | 1 | 14 | 525_569 | 6.333333333333333 | 693.0 | Region | Involved in condensin complex recruitment |
| Hgene | AKAP8 | chr19:15490524 | chr19:15367984 | ENST00000269701 | - | 1 | 14 | 572_589 | 6.333333333333333 | 693.0 | Region | RII-binding |
| Hgene | AKAP8 | chr19:15490524 | chr19:15367984 | ENST00000269701 | - | 1 | 14 | 392_414 | 6.333333333333333 | 693.0 | Zinc finger | C2H2 AKAP95-type 1 |
| Hgene | AKAP8 | chr19:15490524 | chr19:15367984 | ENST00000269701 | - | 1 | 14 | 481_504 | 6.333333333333333 | 693.0 | Zinc finger | C2H2 AKAP95-type 2 |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 368_440 | 447.0 | 1363.0 | Domain | Bromo 2 | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000263377 | 6 | 20 | 75_147 | 447.0 | 1363.0 | Domain | Bromo 1 | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 368_440 | 447.0 | 795.0 | Domain | Bromo 2 | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000360016 | 6 | 12 | 75_147 | 447.0 | 795.0 | Domain | Bromo 1 | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 368_440 | 447.0 | 723.0 | Domain | Bromo 2 | |
| Tgene | BRD4 | chr19:15490524 | chr19:15367984 | ENST00000371835 | 6 | 12 | 75_147 | 447.0 | 723.0 | Domain | Bromo 1 |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| AKAP8 | |
| BRD4 | ![]() |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Hgene | AKAP8 | chr19:15490524 | chr19:15367984 | ENST00000269701 | - | 1 | 14 | 109_201 | 6.333333333333333 | 693.0 | DDX5 |
| Hgene | AKAP8 | chr19:15490524 | chr19:15367984 | ENST00000269701 | - | 1 | 14 | 1_210 | 6.333333333333333 | 693.0 | DPY30 |
| Hgene | AKAP8 | chr19:15490524 | chr19:15367984 | ENST00000269701 | - | 1 | 14 | 1_195 | 6.333333333333333 | 693.0 | MCM2 |
Top |
Related Drugs to AKAP8-BRD4 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to AKAP8-BRD4 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
| Tgene | BRD4 | C0017636 | Glioblastoma | 2 | CTD_human |
| Tgene | BRD4 | C0334588 | Giant Cell Glioblastoma | 2 | CTD_human |
| Tgene | BRD4 | C1621958 | Glioblastoma Multiforme | 2 | CTD_human |
| Tgene | BRD4 | C0002170 | Alopecia | 1 | CTD_human |
| Tgene | BRD4 | C0007102 | Malignant tumor of colon | 1 | CTD_human |
| Tgene | BRD4 | C0009375 | Colonic Neoplasms | 1 | CTD_human |
| Tgene | BRD4 | C0018798 | Congenital Heart Defects | 1 | GENOMICS_ENGLAND |
| Tgene | BRD4 | C0019193 | Hepatitis, Toxic | 1 | CTD_human |
| Tgene | BRD4 | C0020507 | Hyperplasia | 1 | CTD_human |
| Tgene | BRD4 | C0020542 | Pulmonary Hypertension | 1 | CTD_human |
| Tgene | BRD4 | C0025149 | Medulloblastoma | 1 | CTD_human |
| Tgene | BRD4 | C0025958 | Microcephaly | 1 | GENOMICS_ENGLAND |
| Tgene | BRD4 | C0029463 | Osteosarcoma | 1 | CTD_human |
| Tgene | BRD4 | C0033578 | Prostatic Neoplasms | 1 | CTD_human |
| Tgene | BRD4 | C0040136 | Thyroid Neoplasm | 1 | CTD_human |
| Tgene | BRD4 | C0085413 | Polycystic Kidney, Autosomal Dominant | 1 | CTD_human |
| Tgene | BRD4 | C0086873 | Pseudopelade | 1 | CTD_human |
| Tgene | BRD4 | C0151468 | Thyroid Gland Follicular Adenoma | 1 | CTD_human |
| Tgene | BRD4 | C0162311 | Androgenetic Alopecia | 1 | CTD_human |
| Tgene | BRD4 | C0205833 | Medullomyoblastoma | 1 | CTD_human |
| Tgene | BRD4 | C0263477 | Female pattern alopecia (disorder) | 1 | CTD_human |
| Tgene | BRD4 | C0270972 | Cornelia De Lange Syndrome | 1 | CTD_human |
| Tgene | BRD4 | C0278510 | Childhood Medulloblastoma | 1 | CTD_human |
| Tgene | BRD4 | C0278876 | Adult Medulloblastoma | 1 | CTD_human |
| Tgene | BRD4 | C0376358 | Malignant neoplasm of prostate | 1 | CTD_human |
| Tgene | BRD4 | C0549473 | Thyroid carcinoma | 1 | CTD_human |
| Tgene | BRD4 | C0751291 | Desmoplastic Medulloblastoma | 1 | CTD_human |
| Tgene | BRD4 | C0860207 | Drug-Induced Liver Disease | 1 | CTD_human |
| Tgene | BRD4 | C0887850 | Polycystic Kidney, Type 1 Autosomal Dominant Disease | 1 | CTD_human |
| Tgene | BRD4 | C1262760 | Hepatitis, Drug-Induced | 1 | CTD_human |
| Tgene | BRD4 | C1275668 | Melanotic medulloblastoma | 1 | CTD_human |
| Tgene | BRD4 | C1707291 | NUT midline carcinoma | 1 | ORPHANET |
| Tgene | BRD4 | C1802395 | Congenital muscular hypertrophy-cerebral syndrome | 1 | CTD_human |
| Tgene | BRD4 | C1853099 | Cornelia de Lange Syndrome 3 | 1 | CTD_human |
| Tgene | BRD4 | C2751306 | Polycystic kidney disease, type 2 | 1 | CTD_human |
| Tgene | BRD4 | C3658290 | Drug-Induced Acute Liver Injury | 1 | CTD_human |
| Tgene | BRD4 | C3714756 | Intellectual Disability | 1 | GENOMICS_ENGLAND |
| Tgene | BRD4 | C4025871 | Abnormality of the face | 1 | GENOMICS_ENGLAND |
| Tgene | BRD4 | C4083212 | Alopecia, Male Pattern | 1 | CTD_human |
| Tgene | BRD4 | C4277682 | Chemical and Drug Induced Liver Injury | 1 | CTD_human |
| Tgene | BRD4 | C4279912 | Chemically-Induced Liver Toxicity | 1 | CTD_human |
| Tgene | BRD4 | C4551851 | Cornelia de Lange Syndrome 1 | 1 | CTD_human |