| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:GRID1-CXCL12 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: GRID1-CXCL12 | FusionPDB ID: 34743 | FusionGDB2.0 ID: 34743 | Hgene | Tgene | Gene symbol | GRID1 | CXCL12 | Gene ID | 2894 | 6387 |
| Gene name | glutamate ionotropic receptor delta type subunit 1 | C-X-C motif chemokine ligand 12 | |
| Synonyms | GluD1 | IRH|PBSF|SCYB12|SDF1|TLSF|TPAR1 | |
| Cytomap | 10q23.1-q23.2 | 10q11.21 | |
| Type of gene | protein-coding | protein-coding | |
| Description | glutamate receptor ionotropic, delta-1gluR delta-1 subunitglutamate receptor delta-1 subunit | stromal cell-derived factor 1chemokine (C-X-C motif) ligand 12intercrine reduced in hepatomaspre-B cell growth-stimulating factor | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | Q9ULK0 | P48061 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000327946, ENST00000536331, ENST00000552278, | ENST00000343575, ENST00000374426, ENST00000374429, ENST00000395793, ENST00000395794, ENST00000496375, ENST00000395795, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 10 X 8 X 6=480 | 6 X 4 X 4=96 |
| # samples | 11 | 6 | |
| ** MAII score | log2(11/480*10)=-2.12553088208386 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(6/96*10)=-0.678071905112638 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: GRID1 [Title/Abstract] AND CXCL12 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | GRID1(87675943)-CXCL12(44793345), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | GRID1-CXCL12 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. GRID1-CXCL12 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. GRID1-CXCL12 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. GRID1-CXCL12 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Tgene | CXCL12 | GO:0033622 | integrin activation | 29301984 |
| Tgene | CXCL12 | GO:0045785 | positive regulation of cell adhesion | 23620790 |
| Tgene | CXCL12 | GO:0060326 | cell chemotaxis | 18308860 |
| Tgene | CXCL12 | GO:0070098 | chemokine-mediated signaling pathway | 20388803 |
| Tgene | CXCL12 | GO:0090026 | positive regulation of monocyte chemotaxis | 18802065 |
| Tgene | CXCL12 | GO:1902230 | negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage | 20388803 |
| Tgene | CXCL12 | GO:1903237 | negative regulation of leukocyte tethering or rolling | 18308860 |
| Tgene | CXCL12 | GO:2000406 | positive regulation of T cell migration | 23620790 |
| Tgene | CXCL12 | GO:2000669 | negative regulation of dendritic cell apoptotic process | 15059845 |
| Fusion gene breakpoints across GRID1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across CXCL12 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | SKCM | TCGA-ER-A19L-06A | GRID1 | chr10 | 87675943 | - | CXCL12 | chr10 | 44793345 | - |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000327946 | GRID1 | chr10 | 87675943 | - | ENST00000395795 | CXCL12 | chr10 | 44793345 | - | 1174 | 866 | 86 | 991 | 301 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000327946 | ENST00000395795 | GRID1 | chr10 | 87675943 | - | CXCL12 | chr10 | 44793345 | - | 0.004671116 | 0.9953289 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >34743_34743_1_GRID1-CXCL12_GRID1_chr10_87675943_ENST00000327946_CXCL12_chr10_44793345_ENST00000395795_length(amino acids)=301AA_BP=259 MEALTLWLLPWICQCVSVRADSIIHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKITYSIKVIEANNPFQAVQEACDLMTQGILAL VTSTGCASANALQSLTDAMHIPHLFVQRNPGGSPRTACHLNPSPDGEAYTLASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQS FLDQASRLGLDVSLQKVDKNISHVFTSLFTTMKTEELNRYRDTLRRAILLLSPQGAHSFINEAVETNLASKDSHWVFVNELLEYGCTAML -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr10:87675943/chr10:44793345) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| GRID1 | CXCL12 |
| FUNCTION: Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. | FUNCTION: Chemoattractant active on T-lymphocytes and monocytes but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. Binds to the allosteric site (site 2) of integrins and activates integrins ITGAV:ITGB3, ITGA4:ITGB1 and ITGA5:ITGB1 in a CXCR4-independent manner (PubMed:29301984). Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation. Stimulates the proliferation of bone marrow-derived B-cell progenitors in the presence of IL7 as well as growth of stromal cell-dependent pre-B-cells (By similarity). {ECO:0000250|UniProtKB:P40224, ECO:0000269|PubMed:11069075, ECO:0000269|PubMed:11859124, ECO:0000269|PubMed:16107333, ECO:0000269|PubMed:18802065, ECO:0000269|PubMed:19255243, ECO:0000269|PubMed:29301984, ECO:0000269|PubMed:8752281}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000343575 | 0 | 3 | 29_33 | 0 | 90.0 | Region | Receptor and heparin binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000343575 | 0 | 3 | 39_41 | 0 | 90.0 | Region | Note=Receptor binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000343575 | 0 | 3 | 41_51 | 0 | 90.0 | Region | Note=Heparin binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000343575 | 0 | 3 | 48_50 | 0 | 90.0 | Region | Note=Receptor binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000343575 | 0 | 3 | 60_70 | 0 | 90.0 | Region | Note=Receptor binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000374426 | 0 | 4 | 29_33 | 0 | 120.0 | Region | Receptor and heparin binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000374426 | 0 | 4 | 39_41 | 0 | 120.0 | Region | Note=Receptor binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000374426 | 0 | 4 | 41_51 | 0 | 120.0 | Region | Note=Heparin binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000374426 | 0 | 4 | 48_50 | 0 | 120.0 | Region | Note=Receptor binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000374426 | 0 | 4 | 60_70 | 0 | 120.0 | Region | Note=Receptor binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000374429 | 0 | 4 | 29_33 | 0 | 94.0 | Region | Receptor and heparin binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000374429 | 0 | 4 | 39_41 | 0 | 94.0 | Region | Note=Receptor binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000374429 | 0 | 4 | 41_51 | 0 | 94.0 | Region | Note=Heparin binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000374429 | 0 | 4 | 48_50 | 0 | 94.0 | Region | Note=Receptor binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000374429 | 0 | 4 | 60_70 | 0 | 94.0 | Region | Note=Receptor binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000395794 | 0 | 4 | 29_33 | 0 | 141.0 | Region | Receptor and heparin binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000395794 | 0 | 4 | 39_41 | 0 | 141.0 | Region | Note=Receptor binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000395794 | 0 | 4 | 41_51 | 0 | 141.0 | Region | Note=Heparin binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000395794 | 0 | 4 | 48_50 | 0 | 141.0 | Region | Note=Receptor binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000395794 | 0 | 4 | 60_70 | 0 | 141.0 | Region | Note=Receptor binding |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | GRID1 | chr10:87675943 | chr10:44793345 | ENST00000327946 | - | 5 | 16 | 21_562 | 260.0 | 1010.0 | Topological domain | Extracellular |
| Hgene | GRID1 | chr10:87675943 | chr10:44793345 | ENST00000327946 | - | 5 | 16 | 584_637 | 260.0 | 1010.0 | Topological domain | Cytoplasmic |
| Hgene | GRID1 | chr10:87675943 | chr10:44793345 | ENST00000327946 | - | 5 | 16 | 659_830 | 260.0 | 1010.0 | Topological domain | Extracellular |
| Hgene | GRID1 | chr10:87675943 | chr10:44793345 | ENST00000327946 | - | 5 | 16 | 852_1009 | 260.0 | 1010.0 | Topological domain | Cytoplasmic |
| Hgene | GRID1 | chr10:87675943 | chr10:44793345 | ENST00000327946 | - | 5 | 16 | 563_583 | 260.0 | 1010.0 | Transmembrane | Helical |
| Hgene | GRID1 | chr10:87675943 | chr10:44793345 | ENST00000327946 | - | 5 | 16 | 638_658 | 260.0 | 1010.0 | Transmembrane | Helical |
| Hgene | GRID1 | chr10:87675943 | chr10:44793345 | ENST00000327946 | - | 5 | 16 | 831_851 | 260.0 | 1010.0 | Transmembrane | Helical |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000395795 | 2 | 4 | 29_33 | 88.66666666666667 | 91.0 | Region | Receptor and heparin binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000395795 | 2 | 4 | 39_41 | 88.66666666666667 | 91.0 | Region | Note=Receptor binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000395795 | 2 | 4 | 41_51 | 88.66666666666667 | 91.0 | Region | Note=Heparin binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000395795 | 2 | 4 | 48_50 | 88.66666666666667 | 91.0 | Region | Note=Receptor binding | |
| Tgene | CXCL12 | chr10:87675943 | chr10:44793345 | ENST00000395795 | 2 | 4 | 60_70 | 88.66666666666667 | 91.0 | Region | Note=Receptor binding |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| GRID1 | |
| CXCL12 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Hgene | GRID1 | chr10:87675943 | chr10:44793345 | ENST00000327946 | - | 5 | 16 | 21_436 | 260.0 | 1010.0 | CBLN1 |
Top |
Related Drugs to GRID1-CXCL12 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to GRID1-CXCL12 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies