| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:AKT2-NSMAF |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: AKT2-NSMAF | FusionPDB ID: 3482 | FusionGDB2.0 ID: 3482 | Hgene | Tgene | Gene symbol | AKT2 | NSMAF | Gene ID | 208 | 8439 |
| Gene name | AKT serine/threonine kinase 2 | neutral sphingomyelinase activation associated factor | |
| Synonyms | HIHGHH|PKBB|PKBBETA|PRKBB|RAC-BETA | FAN|GRAMD5 | |
| Cytomap | 19q13.2 | 8q12.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | RAC-beta serine/threonine-protein kinasePKB betaRAC-PK-betamurine thymoma viral (v-akt) homolog-2protein kinase Akt-2protein kinase B betaputative v-akt murine thymoma viral oncoprotein 2rac protein kinase betav-akt murine thymoma viral oncogene h | protein FANfactor associated with N-SMase activationfactor associated with neutral sphingomyelinase activationneutral sphingomyelinase (N-SMase) activation associated factor | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | P31751 | . | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000311278, ENST00000392038, ENST00000424901, ENST00000579047, ENST00000581582, | ENST00000519858, ENST00000038176, ENST00000427130, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 14 X 12 X 11=1848 | 3 X 3 X 3=27 |
| # samples | 16 | 3 | |
| ** MAII score | log2(16/1848*10)=-3.52982094652869 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(3/27*10)=0.15200309344505 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: AKT2 [Title/Abstract] AND NSMAF [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | AKT2(40741797)-NSMAF(59508218), # samples:2 | ||
| Anticipated loss of major functional domain due to fusion event. | AKT2-NSMAF seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. AKT2-NSMAF seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. AKT2-NSMAF seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. AKT2-NSMAF seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. AKT2-NSMAF seems lost the major protein functional domain in Hgene partner, which is a CGC due to the frame-shifted ORF. AKT2-NSMAF seems lost the major protein functional domain in Hgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. AKT2-NSMAF seems lost the major protein functional domain in Hgene partner, which is a kinase due to the frame-shifted ORF. AKT2-NSMAF seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | AKT2 | GO:0030335 | positive regulation of cell migration | 25428377 |
| Fusion gene breakpoints across AKT2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across NSMAF (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | PAAD | TCGA-RB-AA9M-01A | AKT2 | chr19 | 40741797 | - | NSMAF | chr8 | 59508218 | - |
| ChimerDB4 | PAAD | TCGA-RB-AA9M | AKT2 | chr19 | 40741797 | - | NSMAF | chr8 | 59508218 | - |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000579047 | AKT2 | chr19 | 40741797 | - | ENST00000038176 | NSMAF | chr8 | 59508218 | - | 2855 | 1291 | 149 | 1294 | 381 |
| ENST00000579047 | AKT2 | chr19 | 40741797 | - | ENST00000427130 | NSMAF | chr8 | 59508218 | - | 2589 | 1291 | 149 | 1294 | 381 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000579047 | ENST00000038176 | AKT2 | chr19 | 40741797 | - | NSMAF | chr8 | 59508218 | - | 0.000801886 | 0.99919814 |
| ENST00000579047 | ENST00000427130 | AKT2 | chr19 | 40741797 | - | NSMAF | chr8 | 59508218 | - | 0.000999725 | 0.99900025 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >3482_3482_1_AKT2-NSMAF_AKT2_chr19_40741797_ENST00000579047_NSMAF_chr8_59508218_ENST00000038176_length(amino acids)=381AA_BP= MPVTGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMR AIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAK DEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENL MLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPR -------------------------------------------------------------- >3482_3482_2_AKT2-NSMAF_AKT2_chr19_40741797_ENST00000579047_NSMAF_chr8_59508218_ENST00000427130_length(amino acids)=381AA_BP= MPVTGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMR AIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAK DEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENL MLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPR -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:40741797/chr8:59508218) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| AKT2 | . |
| FUNCTION: AKT2 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. This is mediated through serine and/or threonine phosphorylation of a range of downstream substrates. Over 100 substrate candidates have been reported so far, but for most of them, no isoform specificity has been reported. AKT is responsible of the regulation of glucose uptake by mediating insulin-induced translocation of the SLC2A4/GLUT4 glucose transporter to the cell surface. Phosphorylation of PTPN1 at 'Ser-50' negatively modulates its phosphatase activity preventing dephosphorylation of the insulin receptor and the attenuation of insulin signaling. Phosphorylation of TBC1D4 triggers the binding of this effector to inhibitory 14-3-3 proteins, which is required for insulin-stimulated glucose transport. AKT regulates also the storage of glucose in the form of glycogen by phosphorylating GSK3A at 'Ser-21' and GSK3B at 'Ser-9', resulting in inhibition of its kinase activity. Phosphorylation of GSK3 isoforms by AKT is also thought to be one mechanism by which cell proliferation is driven. AKT regulates also cell survival via the phosphorylation of MAP3K5 (apoptosis signal-related kinase). Phosphorylation of 'Ser-83' decreases MAP3K5 kinase activity stimulated by oxidative stress and thereby prevents apoptosis. AKT mediates insulin-stimulated protein synthesis by phosphorylating TSC2 at 'Ser-939' and 'Thr-1462', thereby activating mTORC1 signaling and leading to both phosphorylation of 4E-BP1 and in activation of RPS6KB1. AKT is involved in the phosphorylation of members of the FOXO factors (Forkhead family of transcription factors), leading to binding of 14-3-3 proteins and cytoplasmic localization. In particular, FOXO1 is phosphorylated at 'Thr-24', 'Ser-256' and 'Ser-319'. FOXO3 and FOXO4 are phosphorylated on equivalent sites. AKT has an important role in the regulation of NF-kappa-B-dependent gene transcription and positively regulates the activity of CREB1 (cyclic AMP (cAMP)-response element binding protein). The phosphorylation of CREB1 induces the binding of accessory proteins that are necessary for the transcription of pro-survival genes such as BCL2 and MCL1. AKT phosphorylates 'Ser-454' on ATP citrate lyase (ACLY), thereby potentially regulating ACLY activity and fatty acid synthesis. Activates the 3B isoform of cyclic nucleotide phosphodiesterase (PDE3B) via phosphorylation of 'Ser-273', resulting in reduced cyclic AMP levels and inhibition of lipolysis. Phosphorylates PIKFYVE on 'Ser-318', which results in increased PI(3)P-5 activity. The Rho GTPase-activating protein DLC1 is another substrate and its phosphorylation is implicated in the regulation cell proliferation and cell growth. AKT plays a role as key modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of newborn neurons integration during adult neurogenesis, including correct neuron positioning, dendritic development and synapse formation. Signals downstream of phosphatidylinositol 3-kinase (PI(3)K) to mediate the effects of various growth factors such as platelet-derived growth factor (PDGF), epidermal growth factor (EGF), insulin and insulin-like growth factor I (IGF-I). AKT mediates the antiapoptotic effects of IGF-I. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. May be involved in the regulation of the placental development.; FUNCTION: One of the few specific substrates of AKT2 identified recently is PITX2. Phosphorylation of PITX2 impairs its association with the CCND1 mRNA-stabilizing complex thus shortening the half-life of CCND1. AKT2 seems also to be the principal isoform responsible of the regulation of glucose uptake. Phosphorylates C2CD5 on 'Ser-197' during insulin-stimulated adipocytes. AKT2 is also specifically involved in skeletal muscle differentiation, one of its substrates in this process being ANKRD2. Down-regulation by RNA interference reduces the expression of the phosphorylated form of BAD, resulting in the induction of caspase-dependent apoptosis. Phosphorylates CLK2 on 'Thr-343'. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | AKT2 | chr19:40741797 | chr8:59508218 | ENST00000392038 | - | 11 | 14 | 5_108 | 391.6666666666667 | 482.0 | Domain | PH |
| Hgene | AKT2 | chr19:40741797 | chr8:59508218 | ENST00000424901 | - | 10 | 13 | 5_108 | 391.6666666666667 | 482.0 | Domain | PH |
| Hgene | AKT2 | chr19:40741797 | chr8:59508218 | ENST00000392038 | - | 11 | 14 | 158_166 | 391.6666666666667 | 482.0 | Nucleotide binding | ATP |
| Hgene | AKT2 | chr19:40741797 | chr8:59508218 | ENST00000424901 | - | 10 | 13 | 158_166 | 391.6666666666667 | 482.0 | Nucleotide binding | ATP |
| Hgene | AKT2 | chr19:40741797 | chr8:59508218 | ENST00000392038 | - | 11 | 14 | 230_232 | 391.6666666666667 | 482.0 | Region | Note=Inhibitor binding |
| Hgene | AKT2 | chr19:40741797 | chr8:59508218 | ENST00000392038 | - | 11 | 14 | 277_279 | 391.6666666666667 | 482.0 | Region | Note=Inhibitor binding |
| Hgene | AKT2 | chr19:40741797 | chr8:59508218 | ENST00000392038 | - | 11 | 14 | 292_293 | 391.6666666666667 | 482.0 | Region | Note=Inhibitor binding |
| Hgene | AKT2 | chr19:40741797 | chr8:59508218 | ENST00000424901 | - | 10 | 13 | 230_232 | 391.6666666666667 | 482.0 | Region | Note=Inhibitor binding |
| Hgene | AKT2 | chr19:40741797 | chr8:59508218 | ENST00000424901 | - | 10 | 13 | 277_279 | 391.6666666666667 | 482.0 | Region | Note=Inhibitor binding |
| Hgene | AKT2 | chr19:40741797 | chr8:59508218 | ENST00000424901 | - | 10 | 13 | 292_293 | 391.6666666666667 | 482.0 | Region | Note=Inhibitor binding |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000038176 | 20 | 31 | 628_658 | 597.3333333333334 | 918.0 | Repeat | Note=WD 1 | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000038176 | 20 | 31 | 670_700 | 597.3333333333334 | 918.0 | Repeat | Note=WD 2 | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000038176 | 20 | 31 | 712_740 | 597.3333333333334 | 918.0 | Repeat | Note=WD 3 | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000038176 | 20 | 31 | 761_791 | 597.3333333333334 | 918.0 | Repeat | Note=WD 4 | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000038176 | 20 | 31 | 803_833 | 597.3333333333334 | 918.0 | Repeat | Note=WD 5 | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000038176 | 20 | 31 | 884_914 | 597.3333333333334 | 918.0 | Repeat | Note=WD 6 | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000427130 | 20 | 31 | 628_658 | 628.3333333333334 | 949.0 | Repeat | Note=WD 1 | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000427130 | 20 | 31 | 670_700 | 628.3333333333334 | 949.0 | Repeat | Note=WD 2 | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000427130 | 20 | 31 | 712_740 | 628.3333333333334 | 949.0 | Repeat | Note=WD 3 | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000427130 | 20 | 31 | 761_791 | 628.3333333333334 | 949.0 | Repeat | Note=WD 4 | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000427130 | 20 | 31 | 803_833 | 628.3333333333334 | 949.0 | Repeat | Note=WD 5 | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000427130 | 20 | 31 | 884_914 | 628.3333333333334 | 949.0 | Repeat | Note=WD 6 |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | AKT2 | chr19:40741797 | chr8:59508218 | ENST00000392038 | - | 11 | 14 | 152_409 | 391.6666666666667 | 482.0 | Domain | Protein kinase |
| Hgene | AKT2 | chr19:40741797 | chr8:59508218 | ENST00000392038 | - | 11 | 14 | 410_481 | 391.6666666666667 | 482.0 | Domain | AGC-kinase C-terminal |
| Hgene | AKT2 | chr19:40741797 | chr8:59508218 | ENST00000424901 | - | 10 | 13 | 152_409 | 391.6666666666667 | 482.0 | Domain | Protein kinase |
| Hgene | AKT2 | chr19:40741797 | chr8:59508218 | ENST00000424901 | - | 10 | 13 | 410_481 | 391.6666666666667 | 482.0 | Domain | AGC-kinase C-terminal |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000038176 | 20 | 31 | 23_28 | 597.3333333333334 | 918.0 | Compositional bias | Note=Poly-Leu | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000427130 | 20 | 31 | 23_28 | 628.3333333333334 | 949.0 | Compositional bias | Note=Poly-Leu | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000038176 | 20 | 31 | 176_247 | 597.3333333333334 | 918.0 | Domain | Note=GRAM | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000038176 | 20 | 31 | 189_286 | 597.3333333333334 | 918.0 | Domain | BEACH-type PH | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000038176 | 20 | 31 | 290_575 | 597.3333333333334 | 918.0 | Domain | BEACH | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000427130 | 20 | 31 | 176_247 | 628.3333333333334 | 949.0 | Domain | Note=GRAM | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000427130 | 20 | 31 | 189_286 | 628.3333333333334 | 949.0 | Domain | BEACH-type PH | |
| Tgene | NSMAF | chr19:40741797 | chr8:59508218 | ENST00000427130 | 20 | 31 | 290_575 | 628.3333333333334 | 949.0 | Domain | BEACH |
Top |
Fusion Protein Structures |
| PDB and CIF files of the predicted fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| Fusion protein PDB link (fusion AA seq ID in FusionPDB) | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | AA seq | Len(AA seq) |
| PDB file >>>756_AKT2_40741797_NSMAF_59508218_ranked_0.pdb | AKT2 | 40741797 | 40741797 | ENST00000427130 | NSMAF | chr8 | 59508218 | - | MPVTGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMR AIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAK DEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENL MLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPR | 381 |
Top |
pLDDT score distribution |
| pLDDT score distribution of the predicted wild-type structures of two partner proteins from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
AKT2_pLDDT.png  |
NSMAF_pLDDT.png  |
| pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
 |
Top |
Ramachandran Plot of Fusion Protein Structure |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| Fusion AA seq ID in FusionPDB and their Ramachandran plots |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| AKT2 | |
| NSMAF |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to AKT2-NSMAF |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to AKT2-NSMAF |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies