UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:HBA1-GATA1 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: HBA1-GATA1 | FusionPDB ID: 35674 | FusionGDB2.0 ID: 35674 | Hgene | Tgene | Gene symbol | HBA1 | GATA1 | Gene ID | 3039 | 2623 |
Gene name | hemoglobin subunit alpha 1 | GATA binding protein 1 | |
Synonyms | ECYT7|HBA-T3|HBH|METHBA | ERYF1|GATA-1|GF-1|GF1|NF-E1|NFE1|XLANP|XLTDA|XLTT | |
Cytomap | 16p13.3 | Xp11.23 | |
Type of gene | protein-coding | protein-coding | |
Description | hemoglobin subunit alphaalpha globin chainalpha one globinalpha-2 globin chaindelta globinhemoglobin alpha 1 globin chainhemoglobin, alpha 1 | erythroid transcription factorGATA-binding factor 1NF-E1 DNA-binding proteinerythroid transcription factor 1globin transcription factor 1nuclear factor, erythroid 1transcription factor GATA1 | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | P69905 | . | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000320868, ENST00000397797, | ENST00000376665, ENST00000376670, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 3 X 3 X 1=9 | 2 X 2 X 2=8 |
# samples | 3 | 2 | |
** MAII score | log2(3/9*10)=1.73696559416621 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | log2(2/8*10)=1.32192809488736 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: HBA1 [Title/Abstract] AND GATA1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | HBA1(227079)-GATA1(48651594), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | HBA1-GATA1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. HBA1-GATA1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | HBA1 | GO:0010942 | positive regulation of cell death | 19740759 |
Hgene | HBA1 | GO:0042542 | response to hydrogen peroxide | 19740759 |
Hgene | HBA1 | GO:0042744 | hydrogen peroxide catabolic process | 19740759 |
Tgene | GATA1 | GO:0000122 | negative regulation of transcription by RNA polymerase II | 22235304 |
Tgene | GATA1 | GO:0006366 | transcription by RNA polymerase II | 2467208 |
Tgene | GATA1 | GO:0010724 | regulation of definitive erythrocyte differentiation | 12200364|15920471 |
Tgene | GATA1 | GO:0035854 | eosinophil fate commitment | 12045236 |
Tgene | GATA1 | GO:0045893 | positive regulation of transcription, DNA-templated | 24245781 |
Tgene | GATA1 | GO:0045944 | positive regulation of transcription by RNA polymerase II | 12200364|15920471 |
Tgene | GATA1 | GO:0097067 | cellular response to thyroid hormone stimulus | 19375645 |
Tgene | GATA1 | GO:2000678 | negative regulation of transcription regulatory region DNA binding | 15920471 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChiTaRS5.0 | N/A | AI064977 | HBA1 | chr16 | 227079 | - | GATA1 | chrX | 48651594 | + |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000320868 | HBA1 | chr16 | 227079 | - | ENST00000376670 | GATA1 | chrX | 48651594 | + | 811 | 185 | 37 | 666 | 209 |
ENST00000320868 | HBA1 | chr16 | 227079 | - | ENST00000376665 | GATA1 | chrX | 48651594 | + | 471 | 185 | 37 | 429 | 130 |
ENST00000397797 | HBA1 | chr16 | 227079 | - | ENST00000376670 | GATA1 | chrX | 48651594 | + | 738 | 112 | 54 | 593 | 179 |
ENST00000397797 | HBA1 | chr16 | 227079 | - | ENST00000376665 | GATA1 | chrX | 48651594 | + | 398 | 112 | 54 | 356 | 100 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000320868 | ENST00000376670 | HBA1 | chr16 | 227079 | - | GATA1 | chrX | 48651594 | + | 0.60100245 | 0.39899755 |
ENST00000320868 | ENST00000376665 | HBA1 | chr16 | 227079 | - | GATA1 | chrX | 48651594 | + | 0.58496046 | 0.4150395 |
ENST00000397797 | ENST00000376670 | HBA1 | chr16 | 227079 | - | GATA1 | chrX | 48651594 | + | 0.59331 | 0.40669006 |
ENST00000397797 | ENST00000376665 | HBA1 | chr16 | 227079 | - | GATA1 | chrX | 48651594 | + | 0.43130207 | 0.5686979 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >35674_35674_1_HBA1-GATA1_HBA1_chr16_227079_ENST00000320868_GATA1_chrX_48651594_ENST00000376665_length(amino acids)=130AA_BP=49 MVLSPADKTNVKAAWGKVGAHAGEYGAEALESPERPARAQASGGPGQLQAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQHYCG -------------------------------------------------------------- >35674_35674_2_HBA1-GATA1_HBA1_chr16_227079_ENST00000320868_GATA1_chrX_48651594_ENST00000376670_length(amino acids)=209AA_BP=49 MVLSPADKTNVKAAWGKVGAHAGEYGAEALESPERPARAQASGGPGQLQAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRP LTMRKDGIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGTAHLYQGLGPVVLSGPVSHLMPFPG -------------------------------------------------------------- >35674_35674_3_HBA1-GATA1_HBA1_chr16_227079_ENST00000397797_GATA1_chrX_48651594_ENST00000376665_length(amino acids)=100AA_BP=19 MGPERPARAQASGGPGQLQAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQHYCGGSAQLMRAQSMASRGGVVSFSSCSQNSGQP -------------------------------------------------------------- >35674_35674_4_HBA1-GATA1_HBA1_chr16_227079_ENST00000397797_GATA1_chrX_48651594_ENST00000376670_length(amino acids)=179AA_BP=19 MGPERPARAQASGGPGQLQAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRGSSLGGT -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr16:227079/chrX:48651594) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
HBA1 | . |
FUNCTION: Involved in oxygen transport from the lung to the various peripheral tissues. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | GATA1 | chr16:227079 | chrX:48651594 | ENST00000376670 | 0 | 6 | 204_228 | 0 | 414.0 | Zinc finger | GATA-type 1 | |
Tgene | GATA1 | chr16:227079 | chrX:48651594 | ENST00000376670 | 0 | 6 | 258_282 | 0 | 414.0 | Zinc finger | GATA-type 2 |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
HBA1 | |
GATA1 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to HBA1-GATA1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to HBA1-GATA1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |