| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:HLA-F-HLA-A |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: HLA-F-HLA-A | FusionPDB ID: 36711 | FusionGDB2.0 ID: 36711 | Hgene | Tgene | Gene symbol | HLA-F | HLA-A | Gene ID | 3134 | 3105 |
| Gene name | major histocompatibility complex, class I, F | major histocompatibility complex, class I, A | |
| Synonyms | CDA12|HLA-5.4|HLA-CDA12|HLAF | HLAA | |
| Cytomap | 6p22.1 | 6p22.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | HLA class I histocompatibility antigen, alpha chain FHLA F antigenMHC class I antigen Fleukocyte antigen F | HLA class I histocompatibility antigen, A alpha chainHLA class I histocompatibility antigen, A-1 alpha chainMHC class I antigen HLA-A heavy chainleukocyte antigen class I-A | |
| Modification date | 20200313 | 20200328 | |
| UniProtAcc | P30511 | P04439 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000259951, ENST00000334668, ENST00000376861, ENST00000434407, ENST00000342322, ENST00000359076, ENST00000376848, ENST00000383515, ENST00000383516, ENST00000383626, ENST00000383627, ENST00000420067, ENST00000422439, ENST00000422711, ENST00000428296, ENST00000430472, ENST00000435058, ENST00000440587, ENST00000440590, ENST00000444891, ENST00000445657, ENST00000463731, ENST00000475996, ENST00000485297, ENST00000489167, ENST00000490259, ENST00000490874, ENST00000496199, ENST00000547132, ENST00000549067, ENST00000549254, ENST00000549422, ENST00000550932, ENST00000551026, ENST00000551347, ENST00000551780, ENST00000551832, ENST00000552082, ENST00000552880, | ENST00000376802, ENST00000376822, ENST00000383605, ENST00000383619, ENST00000414592, ENST00000416096, ENST00000417978, ENST00000431930, ENST00000438861, ENST00000442939, ENST00000443552, ENST00000444289, ENST00000450342, ENST00000453975, ENST00000454091, ENST00000456012, ENST00000457879, ENST00000488889, ENST00000547112, ENST00000547271, ENST00000547522, ENST00000549224, ENST00000549869, ENST00000550728, ENST00000551120, ENST00000551578, ENST00000552193, ENST00000552493, ENST00000552498, ENST00000376806, ENST00000376809, ENST00000396634, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 1 X 1 X 1=1 | 9 X 9 X 2=162 |
| # samples | 1 | 9 | |
| ** MAII score | log2(1/1*10)=3.32192809488736 | log2(9/162*10)=-0.84799690655495 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: HLA-F [Title/Abstract] AND HLA-A [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | HLA-F(29693808)-HLA-A(29912857), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | HLA-F-HLA-A seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. HLA-F-HLA-A seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | HLA-F | GO:0002476 | antigen processing and presentation of endogenous peptide antigen via MHC class Ib | 28636952 |
| Hgene | HLA-F | GO:0002477 | antigen processing and presentation of exogenous peptide antigen via MHC class Ib | 23851683 |
| Hgene | HLA-F | GO:0002725 | negative regulation of T cell cytokine production | 24018270 |
| Hgene | HLA-F | GO:0002728 | negative regulation of natural killer cell cytokine production | 24018270 |
| Hgene | HLA-F | GO:0002729 | positive regulation of natural killer cell cytokine production | 27455421 |
| Hgene | HLA-F | GO:0043322 | negative regulation of natural killer cell degranulation | 24018270 |
| Hgene | HLA-F | GO:0043323 | positive regulation of natural killer cell degranulation | 27455421 |
| Hgene | HLA-F | GO:0045953 | negative regulation of natural killer cell mediated cytotoxicity | 24018270 |
| Hgene | HLA-F | GO:1901215 | negative regulation of neuron death | 26928464 |
| Tgene | HLA-A | GO:0001913 | T cell mediated cytotoxicity | 7504010 |
| Tgene | HLA-A | GO:0002419 | T cell mediated cytotoxicity directed against tumor cell target | 1402688|17189421|20364150 |
| Tgene | HLA-A | GO:0002726 | positive regulation of T cell cytokine production | 24643698 |
| Tgene | HLA-A | GO:0019885 | antigen processing and presentation of endogenous peptide antigen via MHC class I | 1402688|20364150|24643698 |
| Tgene | HLA-A | GO:0036037 | CD8-positive, alpha-beta T cell activation | 1402688|2784196|7504010|8630735|12138174|17189421|20364150 |
| Tgene | HLA-A | GO:0042590 | antigen processing and presentation of exogenous peptide antigen via MHC class I | 7504010|12138174 |
| Tgene | HLA-A | GO:0050852 | T cell receptor signaling pathway | 10435578 |
| Tgene | HLA-A | GO:2001187 | positive regulation of CD8-positive, alpha-beta T cell activation | 24643698 |
| Fusion gene breakpoints across HLA-F (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across HLA-A (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChiTaRS5.0 | N/A | AW603938 | HLA-F | chr6 | 29693808 | + | HLA-A | chr6 | 29912857 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000376861 | HLA-F | chr6 | 29693808 | + | ENST00000396634 | HLA-A | chr6 | 29912857 | + | 1892 | 1399 | 384 | 1520 | 378 |
| ENST00000376861 | HLA-F | chr6 | 29693808 | + | ENST00000376806 | HLA-A | chr6 | 29912857 | + | 1892 | 1399 | 384 | 1520 | 378 |
| ENST00000376861 | HLA-F | chr6 | 29693808 | + | ENST00000376809 | HLA-A | chr6 | 29912857 | + | 1891 | 1399 | 384 | 1520 | 378 |
| ENST00000334668 | HLA-F | chr6 | 29693808 | + | ENST00000396634 | HLA-A | chr6 | 29912857 | + | 1632 | 1139 | 124 | 1260 | 378 |
| ENST00000334668 | HLA-F | chr6 | 29693808 | + | ENST00000376806 | HLA-A | chr6 | 29912857 | + | 1632 | 1139 | 124 | 1260 | 378 |
| ENST00000334668 | HLA-F | chr6 | 29693808 | + | ENST00000376809 | HLA-A | chr6 | 29912857 | + | 1631 | 1139 | 124 | 1260 | 378 |
| ENST00000259951 | HLA-F | chr6 | 29693808 | + | ENST00000396634 | HLA-A | chr6 | 29912857 | + | 1564 | 1071 | 56 | 1192 | 378 |
| ENST00000259951 | HLA-F | chr6 | 29693808 | + | ENST00000376806 | HLA-A | chr6 | 29912857 | + | 1564 | 1071 | 56 | 1192 | 378 |
| ENST00000259951 | HLA-F | chr6 | 29693808 | + | ENST00000376809 | HLA-A | chr6 | 29912857 | + | 1563 | 1071 | 56 | 1192 | 378 |
| ENST00000434407 | HLA-F | chr6 | 29693808 | + | ENST00000396634 | HLA-A | chr6 | 29912857 | + | 1232 | 739 | 0 | 860 | 286 |
| ENST00000434407 | HLA-F | chr6 | 29693808 | + | ENST00000376806 | HLA-A | chr6 | 29912857 | + | 1232 | 739 | 0 | 860 | 286 |
| ENST00000434407 | HLA-F | chr6 | 29693808 | + | ENST00000376809 | HLA-A | chr6 | 29912857 | + | 1231 | 739 | 0 | 860 | 286 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000376861 | ENST00000396634 | HLA-F | chr6 | 29693808 | + | HLA-A | chr6 | 29912857 | + | 0.002174097 | 0.9978259 |
| ENST00000376861 | ENST00000376806 | HLA-F | chr6 | 29693808 | + | HLA-A | chr6 | 29912857 | + | 0.002174097 | 0.9978259 |
| ENST00000376861 | ENST00000376809 | HLA-F | chr6 | 29693808 | + | HLA-A | chr6 | 29912857 | + | 0.002170474 | 0.9978295 |
| ENST00000334668 | ENST00000396634 | HLA-F | chr6 | 29693808 | + | HLA-A | chr6 | 29912857 | + | 0.002224731 | 0.99777526 |
| ENST00000334668 | ENST00000376806 | HLA-F | chr6 | 29693808 | + | HLA-A | chr6 | 29912857 | + | 0.002224731 | 0.99777526 |
| ENST00000334668 | ENST00000376809 | HLA-F | chr6 | 29693808 | + | HLA-A | chr6 | 29912857 | + | 0.002218743 | 0.9977812 |
| ENST00000259951 | ENST00000396634 | HLA-F | chr6 | 29693808 | + | HLA-A | chr6 | 29912857 | + | 0.002494967 | 0.997505 |
| ENST00000259951 | ENST00000376806 | HLA-F | chr6 | 29693808 | + | HLA-A | chr6 | 29912857 | + | 0.002494967 | 0.997505 |
| ENST00000259951 | ENST00000376809 | HLA-F | chr6 | 29693808 | + | HLA-A | chr6 | 29912857 | + | 0.002493391 | 0.9975067 |
| ENST00000434407 | ENST00000396634 | HLA-F | chr6 | 29693808 | + | HLA-A | chr6 | 29912857 | + | 0.003503154 | 0.99649686 |
| ENST00000434407 | ENST00000376806 | HLA-F | chr6 | 29693808 | + | HLA-A | chr6 | 29912857 | + | 0.003503154 | 0.99649686 |
| ENST00000434407 | ENST00000376809 | HLA-F | chr6 | 29693808 | + | HLA-A | chr6 | 29912857 | + | 0.003464989 | 0.99653494 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >36711_36711_1_HLA-F-HLA-A_HLA-F_chr6_29693808_ENST00000259951_HLA-A_chr6_29912857_ENST00000376806_length(amino acids)=378AA_BP=21 MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKA NAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY LEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVV PPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSAQAAVRLQAVTVPRALMCPSQLVKCE -------------------------------------------------------------- >36711_36711_2_HLA-F-HLA-A_HLA-F_chr6_29693808_ENST00000259951_HLA-A_chr6_29912857_ENST00000376809_length(amino acids)=378AA_BP=21 MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKA NAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY LEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVV PPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSAQAAVRLQAVTVPRALMCPSQLVKCE -------------------------------------------------------------- >36711_36711_3_HLA-F-HLA-A_HLA-F_chr6_29693808_ENST00000259951_HLA-A_chr6_29912857_ENST00000396634_length(amino acids)=378AA_BP=21 MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKA NAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY LEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVV PPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSAQAAVRLQAVTVPRALMCPSQLVKCE -------------------------------------------------------------- >36711_36711_4_HLA-F-HLA-A_HLA-F_chr6_29693808_ENST00000334668_HLA-A_chr6_29912857_ENST00000376806_length(amino acids)=378AA_BP=21 MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKA NAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY LEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVV PPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSAQAAVRLQAVTVPRALMCPSQLVKCE -------------------------------------------------------------- >36711_36711_5_HLA-F-HLA-A_HLA-F_chr6_29693808_ENST00000334668_HLA-A_chr6_29912857_ENST00000376809_length(amino acids)=378AA_BP=21 MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKA NAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY LEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVV PPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSAQAAVRLQAVTVPRALMCPSQLVKCE -------------------------------------------------------------- >36711_36711_6_HLA-F-HLA-A_HLA-F_chr6_29693808_ENST00000334668_HLA-A_chr6_29912857_ENST00000396634_length(amino acids)=378AA_BP=21 MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKA NAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY LEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVV PPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSAQAAVRLQAVTVPRALMCPSQLVKCE -------------------------------------------------------------- >36711_36711_7_HLA-F-HLA-A_HLA-F_chr6_29693808_ENST00000376861_HLA-A_chr6_29912857_ENST00000376806_length(amino acids)=378AA_BP=21 MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKA NAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY LEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVV PPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSAQAAVRLQAVTVPRALMCPSQLVKCE -------------------------------------------------------------- >36711_36711_8_HLA-F-HLA-A_HLA-F_chr6_29693808_ENST00000376861_HLA-A_chr6_29912857_ENST00000376809_length(amino acids)=378AA_BP=21 MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKA NAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY LEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVV PPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSAQAAVRLQAVTVPRALMCPSQLVKCE -------------------------------------------------------------- >36711_36711_9_HLA-F-HLA-A_HLA-F_chr6_29693808_ENST00000376861_HLA-A_chr6_29912857_ENST00000396634_length(amino acids)=378AA_BP=21 MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKA NAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY LEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVV PPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSAQAAVRLQAVTVPRALMCPSQLVKCE -------------------------------------------------------------- >36711_36711_10_HLA-F-HLA-A_HLA-F_chr6_29693808_ENST00000434407_HLA-A_chr6_29912857_ENST00000376806_length(amino acids)=286AA_BP=21 MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKA NAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY LEGECLELLRRYLENGKETLQRAEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSAQAAVRLQAVTVPRALMCPSQLVKCETA -------------------------------------------------------------- >36711_36711_11_HLA-F-HLA-A_HLA-F_chr6_29693808_ENST00000434407_HLA-A_chr6_29912857_ENST00000376809_length(amino acids)=286AA_BP=21 MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKA NAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY LEGECLELLRRYLENGKETLQRAEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSAQAAVRLQAVTVPRALMCPSQLVKCETA -------------------------------------------------------------- >36711_36711_12_HLA-F-HLA-A_HLA-F_chr6_29693808_ENST00000434407_HLA-A_chr6_29912857_ENST00000396634_length(amino acids)=286AA_BP=21 MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKA NAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY LEGECLELLRRYLENGKETLQRAEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSAQAAVRLQAVTVPRALMCPSQLVKCETA -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr6:29693808/chr6:29912857) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| HLA-F | HLA-A |
| FUNCTION: Non-classical major histocompatibility class Ib molecule postulated to play a role in immune surveillance, immune tolerance and inflammation. Functions in two forms, as a heterotrimeric complex with B2M/beta-2 microglobulin and a peptide (peptide-bound HLA-F-B2M) and as an open conformer (OC) devoid of peptide and B2M (peptide-free OC). In complex with B2M, presents non-canonical self-peptides carrying post-translational modifications, particularly phosphorylated self-peptides. Peptide-bound HLA-F-B2M acts as a ligand for LILRB1 inhibitory receptor, a major player in maternal-fetal tolerance. Peptide-free OC acts as a ligand for KIR3DS1 and KIR3DL2 receptors (PubMed:28636952). Upon interaction with activating KIR3DS1 receptor on NK cells, triggers NK cell degranulation and anti-viral cytokine production (PubMed:27455421). Through interaction with KIR3DL2 receptor, inhibits NK and T cell effector functions (PubMed:24018270). May interact with other MHC class I OCs to cross-present exogenous viral, tumor or minor histompatibility antigens to cytotoxic CD8+ T cells, triggering effector and memory responses (PubMed:23851683). May play a role in inflammatory responses in the peripheral nervous system. Through interaction with KIR3DL2, may protect motor neurons from astrocyte-induced toxicity (PubMed:26928464). {ECO:0000269|PubMed:23851683, ECO:0000269|PubMed:24018270, ECO:0000269|PubMed:26928464, ECO:0000269|PubMed:27455421, ECO:0000269|PubMed:28636952}. | FUNCTION: Antigen-presenting major histocompatibility complex class I (MHCI) molecule. In complex with B2M/beta 2 microglobulin displays primarily viral and tumor-derived peptides on antigen-presenting cells for recognition by alpha-beta T cell receptor (TCR) on HLA-A-restricted CD8-positive T cells, guiding antigen-specific T cell immune response to eliminate infected or transformed cells (PubMed:2456340, PubMed:2784196, PubMed:1402688, PubMed:7504010, PubMed:9862734, PubMed:10449296, PubMed:12138174, PubMed:12393434, PubMed:15893615, PubMed:17189421, PubMed:19543285, PubMed:21498667, PubMed:24192765, PubMed:7694806, PubMed:24395804, PubMed:28250417). May also present self-peptides derived from the signal sequence of secreted or membrane proteins, although T cells specific for these peptides are usually inactivated to prevent autoreactivity (PubMed:25880248, PubMed:7506728, PubMed:7679507). Both the peptide and the MHC molecule are recognized by TCR, the peptide is responsible for the fine specificity of antigen recognition and MHC residues account for the MHC restriction of T cells (PubMed:12796775, PubMed:18275829, PubMed:19542454, PubMed:28250417). Typically presents intracellular peptide antigens of 8 to 13 amino acids that arise from cytosolic proteolysis via IFNG-induced immunoproteasome or via endopeptidase IDE/insulin-degrading enzyme (PubMed:17189421, PubMed:20364150, PubMed:17079320, PubMed:26929325, PubMed:27049119). Can bind different peptides containing allele-specific binding motifs, which are mainly defined by anchor residues at position 2 and 9 (PubMed:7504010, PubMed:9862734). {ECO:0000269|PubMed:10449296, ECO:0000269|PubMed:12138174, ECO:0000269|PubMed:12393434, ECO:0000269|PubMed:12796775, ECO:0000269|PubMed:1402688, ECO:0000269|PubMed:15893615, ECO:0000269|PubMed:17079320, ECO:0000269|PubMed:17189421, ECO:0000269|PubMed:18275829, ECO:0000269|PubMed:19542454, ECO:0000269|PubMed:19543285, ECO:0000269|PubMed:20364150, ECO:0000269|PubMed:21498667, ECO:0000269|PubMed:24192765, ECO:0000269|PubMed:24395804, ECO:0000269|PubMed:2456340, ECO:0000269|PubMed:25880248, ECO:0000269|PubMed:26929325, ECO:0000269|PubMed:27049119, ECO:0000269|PubMed:2784196, ECO:0000269|PubMed:28250417, ECO:0000269|PubMed:7504010, ECO:0000269|PubMed:7506728, ECO:0000269|PubMed:7679507, ECO:0000269|PubMed:7694806, ECO:0000269|PubMed:9862734}.; FUNCTION: Allele A*01:01: Presents a restricted peptide repertoire including viral epitopes derived from IAV NP/nucleoprotein (CTELKLSDY), IAV PB1/polymerase basic protein 1 (VSDGGPNLY), HAdV-11 capsid L3/hexon protein (LTDLGQNLLY), SARS-CoV-2 3a/ORF3a (FTSDYYQLY) as well as tumor peptide antigens including MAGE1 (EADPTGHSY), MAGEA3 (EVDPIGHLY) and WT1 (TSEKRPFMCAY), all having in common a canonical motif with a negatively charged Asp or Glu residue at position 3 and a Tyr anchor residue at the C-terminus (PubMed:1402688, PubMed:7504010, PubMed:17189421, PubMed:20364150, PubMed:25880248, PubMed:30530481, PubMed:19177349, PubMed:24395804, PubMed:26758806, PubMed:32887977). A number of HLA-A*01:01-restricted peptides carry a post-translational modification with oxidation and N-terminal acetylation being the most frequent (PubMed:25880248). Fails to present highly immunogenic peptides from the EBV latent antigens (PubMed:18779413). {ECO:0000269|PubMed:1402688, ECO:0000269|PubMed:17189421, ECO:0000269|PubMed:18779413, ECO:0000269|PubMed:19177349, ECO:0000269|PubMed:20364150, ECO:0000269|PubMed:24395804, ECO:0000269|PubMed:25880248, ECO:0000269|PubMed:26758806, ECO:0000269|PubMed:30530481, ECO:0000269|PubMed:7504010}.; FUNCTION: Allele A*02:01: A major allele in human populations, presents immunodominant viral epitopes derived from IAV M/matrix protein 1 (GILGFVFTL), HIV-1 env (TLTSCNTSV), HIV-1 gag-pol (ILKEPVHGV), HTLV-1 Tax (LLFGYPVYV), HBV C/core antigen (FLPSDFFPS), HCMV UL83/pp65 (NLVPMVATV) as well as tumor peptide antigens including MAGEA4 (GVYDGREHTV), WT1 (RMFPNAPYL) and CTAG1A/NY-ESO-1 (SLLMWITQC), all having in common hydrophobic amino acids at position 2 and at the C-terminal anchors. {ECO:0000269|PubMed:11502003, ECO:0000269|PubMed:12138174, ECO:0000269|PubMed:12796775, ECO:0000269|PubMed:17079320, ECO:0000269|PubMed:18275829, ECO:0000269|PubMed:19542454, ECO:0000269|PubMed:20619457, ECO:0000269|PubMed:22245737, ECO:0000269|PubMed:26929325, ECO:0000269|PubMed:2784196, ECO:0000269|PubMed:28250417, ECO:0000269|PubMed:7694806, ECO:0000269|PubMed:7935798, ECO:0000269|PubMed:8630735, ECO:0000269|PubMed:8805302, ECO:0000269|PubMed:8906788, ECO:0000269|PubMed:9177355}.; FUNCTION: Allele A*03:01: Presents viral epitopes derived from IAV NP (ILRGSVAHK), HIV-1 nef (QVPLRPMTYK), HIV-1 gag-pol (AIFQSSMTK), SARS-CoV-2 N/nucleoprotein (KTFPPTEPK) as well as tumor peptide antigens including PMEL (LIYRRRLMK), NODAL (HAYIQSLLK), TRP-2 (RMYNMVPFF), all having in common hydrophobic amino acids at position 2 and Lys or Arg anchor residues at the C-terminus (PubMed:7504010, PubMed:7679507, PubMed:9862734, PubMed:19543285, PubMed:21943705, PubMed:2456340, PubMed:32887977). May also display spliced peptides resulting from the ligation of two separate proteasomal cleavage products that are not contiguous in the parental protein (PubMed:27049119). {ECO:0000269|PubMed:19543285, ECO:0000269|PubMed:21943705, ECO:0000269|PubMed:2456340, ECO:0000269|PubMed:27049119, ECO:0000269|PubMed:7504010, ECO:0000269|PubMed:7679507, ECO:0000269|PubMed:9862734}.; FUNCTION: Allele A*11:01: Presents several immunodominant epitopes derived from HIV-1 gag-pol and HHV-4 EBNA4, containing the peptide motif with Val, Ile, Thr, Leu, Tyr or Phe at position 2 and Lys anchor residue at the C-terminus. Important in the control of HIV-1, EBV and HBV infections (PubMed:10449296). Presents an immunodominant epitope derived from SARS-CoV-2 N/nucleoprotein (KTFPPTEPK) (PubMed:32887977). {ECO:0000269|PubMed:10449296, ECO:0000269|PubMed:32887977}.; FUNCTION: Allele A*23:01: Interacts with natural killer (NK) cell receptor KIR3DL1 and may contribute to functional maturation of NK cells and self-nonself discrimination during innate immune response. {ECO:0000269|PubMed:17182537}.; FUNCTION: Allele A*24:02: Presents viral epitopes derived from HIV-1 nef (RYPLTFGWCF), EBV lytic- and latent-cycle antigens BRLF1 (TYPVLEEMF), BMLF1 (DYNFVKQLF) and LMP2 (IYVLVMLVL), SARS-CoV nucleocapsid/N (QFKDNVILL), as well as tumor peptide antigens including PRAME (LYVDSLFFL), all sharing a common signature motif, namely an aromatic residue Tyr or Phe at position 2 and a nonhydrophobic anchor residue Phe, Leu or Iso at the C-terminus (PubMed:9047241, PubMed:12393434, PubMed:24192765, PubMed:20844028). Interacts with natural killer (NK) cell receptor KIR3DL1 and may contribute to functional maturation of NK cells and self-nonself discrimination during innate immune response (PubMed:17182537, PubMed:18502829). {ECO:0000269|PubMed:12393434, ECO:0000269|PubMed:17182537, ECO:0000269|PubMed:18502829, ECO:0000269|PubMed:20844028, ECO:0000269|PubMed:24192765, ECO:0000269|PubMed:9047241}.; FUNCTION: Allele A*26:01: Presents several epitopes derived from HIV-1 gag-pol (EVIPMFSAL, ETKLGKAGY) and env (LVSDGGPNLY), carrying as anchor residues preferentially Glu at position 1, Val or Thr at position 2 and Tyr at the C-terminus. {ECO:0000269|PubMed:15893615}.; FUNCTION: Allele A*29:02: Presents peptides having a common motif, namely a Glu residue at position 2 and Tyr or Leu anchor residues at the C-terminus. {ECO:0000269|PubMed:8622959}.; FUNCTION: Allele A*32:01: Interacts with natural killer (NK) cell receptor KIR3DL1 and may contribute to functional maturation of NK cells and self-nonself discrimination during innate immune response. {ECO:0000269|PubMed:17182537}.; FUNCTION: Allele A*68:01: Presents viral epitopes derived from IAV NP (KTGGPIYKR) and HIV-1 tat (ITKGLGISYGR), having a common signature motif namely, Val or Thr at position 2 and positively charged residues Arg or Lys at the C-terminal anchor. {ECO:0000269|PubMed:1448153, ECO:0000269|PubMed:1448154, ECO:0000269|PubMed:2784196}.; FUNCTION: Allele A*74:01: Presents immunodominant HIV-1 epitopes derived from gag-pol (GQMVHQAISPR, QIYPGIKVR) and rev (RQIHSISER), carrying an aliphatic residue at position 2 and Arg anchor residue at the C-terminus. May contribute to viral load control in chronic HIV-1 infection. {ECO:0000269|PubMed:21498667}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000259951 | + | 1 | 7 | 206_296 | 0 | 443.0 | Domain | Ig-like C1-type |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000334668 | + | 1 | 7 | 206_296 | 0 | 347.0 | Domain | Ig-like C1-type |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000359076 | + | 1 | 6 | 206_296 | 0.0 | 255.0 | Domain | Ig-like C1-type |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000376848 | + | 1 | 6 | 206_296 | 0.0 | 255.0 | Domain | Ig-like C1-type |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000376861 | + | 1 | 8 | 206_296 | 0 | 347.0 | Domain | Ig-like C1-type |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000383515 | + | 1 | 6 | 206_296 | 0.0 | 255.0 | Domain | Ig-like C1-type |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000420067 | + | 1 | 6 | 206_296 | 0.0 | 255.0 | Domain | Ig-like C1-type |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000434407 | + | 1 | 6 | 206_296 | 0.0 | 255.0 | Domain | Ig-like C1-type |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000440590 | + | 1 | 6 | 206_296 | 0.0 | 255.0 | Domain | Ig-like C1-type |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000259951 | + | 1 | 7 | 112_203 | 0 | 443.0 | Region | Note=Alpha-2 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000259951 | + | 1 | 7 | 22_111 | 0 | 443.0 | Region | Note=Alpha-1 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000259951 | + | 1 | 7 | 296_305 | 0 | 443.0 | Region | Note=Connecting peptide |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000334668 | + | 1 | 7 | 112_203 | 0 | 347.0 | Region | Note=Alpha-2 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000334668 | + | 1 | 7 | 22_111 | 0 | 347.0 | Region | Note=Alpha-1 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000334668 | + | 1 | 7 | 296_305 | 0 | 347.0 | Region | Note=Connecting peptide |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000359076 | + | 1 | 6 | 112_203 | 0.0 | 255.0 | Region | Note=Alpha-2 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000359076 | + | 1 | 6 | 22_111 | 0.0 | 255.0 | Region | Note=Alpha-1 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000359076 | + | 1 | 6 | 296_305 | 0.0 | 255.0 | Region | Note=Connecting peptide |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000376848 | + | 1 | 6 | 112_203 | 0.0 | 255.0 | Region | Note=Alpha-2 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000376848 | + | 1 | 6 | 22_111 | 0.0 | 255.0 | Region | Note=Alpha-1 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000376848 | + | 1 | 6 | 296_305 | 0.0 | 255.0 | Region | Note=Connecting peptide |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000376861 | + | 1 | 8 | 112_203 | 0 | 347.0 | Region | Note=Alpha-2 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000376861 | + | 1 | 8 | 22_111 | 0 | 347.0 | Region | Note=Alpha-1 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000376861 | + | 1 | 8 | 296_305 | 0 | 347.0 | Region | Note=Connecting peptide |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000383515 | + | 1 | 6 | 112_203 | 0.0 | 255.0 | Region | Note=Alpha-2 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000383515 | + | 1 | 6 | 22_111 | 0.0 | 255.0 | Region | Note=Alpha-1 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000383515 | + | 1 | 6 | 296_305 | 0.0 | 255.0 | Region | Note=Connecting peptide |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000420067 | + | 1 | 6 | 112_203 | 0.0 | 255.0 | Region | Note=Alpha-2 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000420067 | + | 1 | 6 | 22_111 | 0.0 | 255.0 | Region | Note=Alpha-1 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000420067 | + | 1 | 6 | 296_305 | 0.0 | 255.0 | Region | Note=Connecting peptide |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000434407 | + | 1 | 6 | 112_203 | 0.0 | 255.0 | Region | Note=Alpha-2 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000434407 | + | 1 | 6 | 22_111 | 0.0 | 255.0 | Region | Note=Alpha-1 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000434407 | + | 1 | 6 | 296_305 | 0.0 | 255.0 | Region | Note=Connecting peptide |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000440590 | + | 1 | 6 | 112_203 | 0.0 | 255.0 | Region | Note=Alpha-2 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000440590 | + | 1 | 6 | 22_111 | 0.0 | 255.0 | Region | Note=Alpha-1 |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000440590 | + | 1 | 6 | 296_305 | 0.0 | 255.0 | Region | Note=Connecting peptide |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000259951 | + | 1 | 7 | 22_305 | 0 | 443.0 | Topological domain | Extracellular |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000259951 | + | 1 | 7 | 330_346 | 0 | 443.0 | Topological domain | Cytoplasmic |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000334668 | + | 1 | 7 | 22_305 | 0 | 347.0 | Topological domain | Extracellular |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000334668 | + | 1 | 7 | 330_346 | 0 | 347.0 | Topological domain | Cytoplasmic |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000359076 | + | 1 | 6 | 22_305 | 0.0 | 255.0 | Topological domain | Extracellular |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000359076 | + | 1 | 6 | 330_346 | 0.0 | 255.0 | Topological domain | Cytoplasmic |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000376848 | + | 1 | 6 | 22_305 | 0.0 | 255.0 | Topological domain | Extracellular |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000376848 | + | 1 | 6 | 330_346 | 0.0 | 255.0 | Topological domain | Cytoplasmic |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000376861 | + | 1 | 8 | 22_305 | 0 | 347.0 | Topological domain | Extracellular |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000376861 | + | 1 | 8 | 330_346 | 0 | 347.0 | Topological domain | Cytoplasmic |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000383515 | + | 1 | 6 | 22_305 | 0.0 | 255.0 | Topological domain | Extracellular |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000383515 | + | 1 | 6 | 330_346 | 0.0 | 255.0 | Topological domain | Cytoplasmic |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000420067 | + | 1 | 6 | 22_305 | 0.0 | 255.0 | Topological domain | Extracellular |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000420067 | + | 1 | 6 | 330_346 | 0.0 | 255.0 | Topological domain | Cytoplasmic |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000434407 | + | 1 | 6 | 22_305 | 0.0 | 255.0 | Topological domain | Extracellular |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000434407 | + | 1 | 6 | 330_346 | 0.0 | 255.0 | Topological domain | Cytoplasmic |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000440590 | + | 1 | 6 | 22_305 | 0.0 | 255.0 | Topological domain | Extracellular |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000440590 | + | 1 | 6 | 330_346 | 0.0 | 255.0 | Topological domain | Cytoplasmic |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000259951 | + | 1 | 7 | 306_329 | 0 | 443.0 | Transmembrane | Helical |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000334668 | + | 1 | 7 | 306_329 | 0 | 347.0 | Transmembrane | Helical |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000359076 | + | 1 | 6 | 306_329 | 0.0 | 255.0 | Transmembrane | Helical |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000376848 | + | 1 | 6 | 306_329 | 0.0 | 255.0 | Transmembrane | Helical |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000376861 | + | 1 | 8 | 306_329 | 0 | 347.0 | Transmembrane | Helical |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000383515 | + | 1 | 6 | 306_329 | 0.0 | 255.0 | Transmembrane | Helical |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000420067 | + | 1 | 6 | 306_329 | 0.0 | 255.0 | Transmembrane | Helical |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000434407 | + | 1 | 6 | 306_329 | 0.0 | 255.0 | Transmembrane | Helical |
| Hgene | HLA-F | chr6:29693808 | chr6:29912857 | ENST00000440590 | + | 1 | 6 | 306_329 | 0.0 | 255.0 | Transmembrane | Helical |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| HLA-F | |
| HLA-A |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to HLA-F-HLA-A |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to HLA-F-HLA-A |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies