UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:INSR-ERCC1 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: INSR-ERCC1 | FusionPDB ID: 39897 | FusionGDB2.0 ID: 39897 | Hgene | Tgene | Gene symbol | INSR | ERCC1 | Gene ID | 3643 | 2067 |
Gene name | insulin receptor | ERCC excision repair 1, endonuclease non-catalytic subunit | |
Synonyms | CD220|HHF5 | COFS4|RAD10|UV20 | |
Cytomap | 19p13.2 | 19q13.32 | |
Type of gene | protein-coding | protein-coding | |
Description | insulin receptorIR | DNA excision repair protein ERCC-1excision repair cross-complementation group 1excision repair cross-complementing rodent repair deficiency, complementation group 1 (includes overlapping antisense sequence) | |
Modification date | 20200313 | 20200329 | |
UniProtAcc | P06213 | P07992 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000302850, ENST00000341500, | ENST00000013807, ENST00000300853, ENST00000340192, ENST00000423698, ENST00000589165, ENST00000591636, ENST00000588738, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 11 X 11 X 6=726 | 10 X 8 X 5=400 |
# samples | 15 | 11 | |
** MAII score | log2(15/726*10)=-2.27500704749987 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(11/400*10)=-1.86249647625006 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: INSR [Title/Abstract] AND ERCC1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | INSR(7293803)-ERCC1(45926639), # samples:2 | ||
Anticipated loss of major functional domain due to fusion event. | INSR-ERCC1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. INSR-ERCC1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. INSR-ERCC1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. INSR-ERCC1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | INSR | GO:0001934 | positive regulation of protein phosphorylation | 7556070 |
Hgene | INSR | GO:0002092 | positive regulation of receptor internalization | 25401701 |
Hgene | INSR | GO:0007186 | G protein-coupled receptor signaling pathway | 9092559 |
Hgene | INSR | GO:0008284 | positive regulation of cell proliferation | 17925406 |
Hgene | INSR | GO:0008286 | insulin receptor signaling pathway | 6849137|8440175|20455999 |
Hgene | INSR | GO:0018108 | peptidyl-tyrosine phosphorylation | 8496180 |
Hgene | INSR | GO:0032148 | activation of protein kinase B activity | 7556070 |
Hgene | INSR | GO:0032869 | cellular response to insulin stimulus | 8440175 |
Hgene | INSR | GO:0043410 | positive regulation of MAPK cascade | 20455999 |
Hgene | INSR | GO:0045725 | positive regulation of glycogen biosynthetic process | 17925406 |
Hgene | INSR | GO:0046326 | positive regulation of glucose import | 3518947 |
Hgene | INSR | GO:0046777 | protein autophosphorylation | 6849137|8496180 |
Hgene | INSR | GO:0060267 | positive regulation of respiratory burst | 9092559 |
Tgene | ERCC1 | GO:0006289 | nucleotide-excision repair | 3290851 |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | OV | TCGA-24-2027-01A | INSR | chr19 | 7293803 | - | ERCC1 | chr19 | 45924651 | - |
ChimerDB4 | OV | TCGA-24-2027-01A | INSR | chr19 | 7293803 | - | ERCC1 | chr19 | 45926639 | - |
ChimerDB4 | OV | TCGA-24-2027 | INSR | chr19 | 7293802 | - | ERCC1 | chr19 | 45926639 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000341500 | INSR | chr19 | 7293803 | - | ENST00000300853 | ERCC1 | chr19 | 45924651 | - | 3271 | 140 | 2418 | 1102 | 438 |
ENST00000302850 | INSR | chr19 | 7293803 | - | ENST00000300853 | ERCC1 | chr19 | 45924651 | - | 3374 | 243 | 2521 | 1205 | 438 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000341500 | ENST00000300853 | INSR | chr19 | 7293803 | - | ERCC1 | chr19 | 45924651 | - | 0.79874873 | 0.2012513 |
ENST00000302850 | ENST00000300853 | INSR | chr19 | 7293803 | - | ERCC1 | chr19 | 45924651 | - | 0.78548986 | 0.21451019 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >39897_39897_1_INSR-ERCC1_INSR_chr19_7293803_ENST00000302850_ERCC1_chr19_45924651_ENST00000300853_length(amino acids)=438AA_BP= MAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEGPQQSLSGSPLQPIPASPPPQIPPGLRPRFCAFGGNPPVTGPR SALAPNLLTSGKKKKEMQVTEAPVTQEAVNGHGALEVDMALGSPEMDVRKKKKKKNQQLKEPEAAGPVGTEPTVETLEPLGVLFPSTTKK RKKPKGKETFEPEDKTVKQEQINTEPLEDTVLSPTKKRKRQKGTEGMEPEEGVTVESQPQVKVEPLEEAIPLPPTKKRKKEKGQMAMMEP GTEAMEPVEPEMKPLESPGGTMAPQQPEGAKPQAQAALAAPKKKTKKEKQQDATVEPETEVVGPELPDDLEPQAAPTSTKKKKKKKERGH -------------------------------------------------------------- >39897_39897_2_INSR-ERCC1_INSR_chr19_7293803_ENST00000341500_ERCC1_chr19_45924651_ENST00000300853_length(amino acids)=438AA_BP= MAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEGPQQSLSGSPLQPIPASPPPQIPPGLRPRFCAFGGNPPVTGPR SALAPNLLTSGKKKKEMQVTEAPVTQEAVNGHGALEVDMALGSPEMDVRKKKKKKNQQLKEPEAAGPVGTEPTVETLEPLGVLFPSTTKK RKKPKGKETFEPEDKTVKQEQINTEPLEDTVLSPTKKRKRQKGTEGMEPEEGVTVESQPQVKVEPLEEAIPLPPTKKRKKEKGQMAMMEP GTEAMEPVEPEMKPLESPGGTMAPQQPEGAKPQAQAALAAPKKKTKKEKQQDATVEPETEVVGPELPDDLEPQAAPTSTKKKKKKKERGH -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr19:7293803/chr19:45926639) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
INSR | ERCC1 |
FUNCTION: Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL and other signaling intermediates. Each of these phosphorylated proteins serve as docking proteins for other signaling proteins that contain Src-homology-2 domains (SH2 domain) that specifically recognize different phosphotyrosine residues, including the p85 regulatory subunit of PI3K and SHP2. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT/PKB pathway, which is responsible for most of the metabolic actions of insulin, and the Ras-MAPK pathway, which regulates expression of some genes and cooperates with the PI3K pathway to control cell growth and differentiation. Binding of the SH2 domains of PI3K to phosphotyrosines on IRS1 leads to the activation of PI3K and the generation of phosphatidylinositol-(3, 4, 5)-triphosphate (PIP3), a lipid second messenger, which activates several PIP3-dependent serine/threonine kinases, such as PDPK1 and subsequently AKT/PKB. The net effect of this pathway is to produce a translocation of the glucose transporter SLC2A4/GLUT4 from cytoplasmic vesicles to the cell membrane to facilitate glucose transport. Moreover, upon insulin stimulation, activated AKT/PKB is responsible for: anti-apoptotic effect of insulin by inducing phosphorylation of BAD; regulates the expression of gluconeogenic and lipogenic enzymes by controlling the activity of the winged helix or forkhead (FOX) class of transcription factors. Another pathway regulated by PI3K-AKT/PKB activation is mTORC1 signaling pathway which regulates cell growth and metabolism and integrates signals from insulin. AKT mediates insulin-stimulated protein synthesis by phosphorylating TSC2 thereby activating mTORC1 pathway. The Ras/RAF/MAP2K/MAPK pathway is mainly involved in mediating cell growth, survival and cellular differentiation of insulin. Phosphorylated IRS1 recruits GRB2/SOS complex, which triggers the activation of the Ras/RAF/MAP2K/MAPK pathway. In addition to binding insulin, the insulin receptor can bind insulin-like growth factors (IGFI and IGFII). Isoform Short has a higher affinity for IGFII binding. When present in a hybrid receptor with IGF1R, binds IGF1. PubMed:12138094 shows that hybrid receptors composed of IGF1R and INSR isoform Long are activated with a high affinity by IGF1, with low affinity by IGF2 and not significantly activated by insulin, and that hybrid receptors composed of IGF1R and INSR isoform Short are activated by IGF1, IGF2 and insulin. In contrast, PubMed:16831875 shows that hybrid receptors composed of IGF1R and INSR isoform Long and hybrid receptors composed of IGF1R and INSR isoform Short have similar binding characteristics, both bind IGF1 and have a low affinity for insulin. In adipocytes, inhibits lipolysis (By similarity). {ECO:0000250|UniProtKB:P15208, ECO:0000269|PubMed:12138094, ECO:0000269|PubMed:16314505, ECO:0000269|PubMed:16831875, ECO:0000269|PubMed:8257688, ECO:0000269|PubMed:8276809, ECO:0000269|PubMed:8452530, ECO:0000269|PubMed:9428692}. | FUNCTION: [Isoform 1]: Non-catalytic component of a structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair. Responsible, in conjunction with SLX4, for the first step in the repair of interstrand cross-links (ICL). Participates in the processing of anaphase bridge-generating DNA structures, which consist in incompletely processed DNA lesions arising during S or G2 phase, and can result in cytokinesis failure. Also required for homology-directed repair (HDR) of DNA double-strand breaks, in conjunction with SLX4. {ECO:0000269|PubMed:17273966, ECO:0000269|PubMed:23623389, ECO:0000269|PubMed:24036546}.; FUNCTION: [Isoform 2]: Not functional in the nucleotide excision repair pathway. {ECO:0000305|PubMed:24036546}.; FUNCTION: [Isoform 3]: Not functional in the nucleotide excision repair pathway. {ECO:0000305|PubMed:24036546}.; FUNCTION: [Isoform 4]: Not functional in the nucleotide excision repair pathway. {ECO:0000305|PubMed:24036546}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | ERCC1 | chr19:7293803 | chr19:45924651 | ENST00000013807 | 0 | 8 | 134_156 | 35.0 | 324.0 | DNA binding | Ontology_term=ECO:0000255 | |
Tgene | ERCC1 | chr19:7293803 | chr19:45924651 | ENST00000300853 | 1 | 10 | 134_156 | 35.0 | 298.0 | DNA binding | Ontology_term=ECO:0000255 | |
Tgene | ERCC1 | chr19:7293803 | chr19:45924651 | ENST00000340192 | 1 | 9 | 134_156 | 35.0 | 274.0 | DNA binding | Ontology_term=ECO:0000255 | |
Tgene | ERCC1 | chr19:7293803 | chr19:45924651 | ENST00000423698 | 0 | 9 | 134_156 | 0 | 226.0 | DNA binding | Ontology_term=ECO:0000255 | |
Tgene | ERCC1 | chr19:7293803 | chr19:45924651 | ENST00000589165 | 1 | 10 | 134_156 | 35.0 | 298.0 | DNA binding | Ontology_term=ECO:0000255 | |
Tgene | ERCC1 | chr19:7293803 | chr19:45924651 | ENST00000423698 | 0 | 9 | 17_23 | 0 | 226.0 | Motif | Nuclear localization signal | |
Tgene | ERCC1 | chr19:7293803 | chr19:45924651 | ENST00000013807 | 0 | 8 | 220_297 | 35.0 | 324.0 | Region | HhH2%2C dimerization with ERCC4/XPF | |
Tgene | ERCC1 | chr19:7293803 | chr19:45924651 | ENST00000300853 | 1 | 10 | 220_297 | 35.0 | 298.0 | Region | HhH2%2C dimerization with ERCC4/XPF | |
Tgene | ERCC1 | chr19:7293803 | chr19:45924651 | ENST00000340192 | 1 | 9 | 220_297 | 35.0 | 274.0 | Region | HhH2%2C dimerization with ERCC4/XPF | |
Tgene | ERCC1 | chr19:7293803 | chr19:45924651 | ENST00000423698 | 0 | 9 | 220_297 | 0 | 226.0 | Region | HhH2%2C dimerization with ERCC4/XPF | |
Tgene | ERCC1 | chr19:7293803 | chr19:45924651 | ENST00000589165 | 1 | 10 | 220_297 | 35.0 | 298.0 | Region | HhH2%2C dimerization with ERCC4/XPF |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000302850 | - | 1 | 22 | 182_339 | 33.333333333333336 | 1383.0 | Compositional bias | Note=Cys-rich |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000302850 | - | 1 | 22 | 28_174 | 33.333333333333336 | 1383.0 | Compositional bias | Note=Leu-rich |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000341500 | - | 1 | 21 | 182_339 | 33.333333333333336 | 1371.0 | Compositional bias | Note=Cys-rich |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000341500 | - | 1 | 21 | 28_174 | 33.333333333333336 | 1371.0 | Compositional bias | Note=Leu-rich |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000302850 | - | 1 | 22 | 1023_1298 | 33.333333333333336 | 1383.0 | Domain | Protein kinase |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000302850 | - | 1 | 22 | 624_726 | 33.333333333333336 | 1383.0 | Domain | Fibronectin type-III 1 |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000302850 | - | 1 | 22 | 757_842 | 33.333333333333336 | 1383.0 | Domain | Fibronectin type-III 2 |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000302850 | - | 1 | 22 | 853_947 | 33.333333333333336 | 1383.0 | Domain | Fibronectin type-III 3 |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000341500 | - | 1 | 21 | 1023_1298 | 33.333333333333336 | 1371.0 | Domain | Protein kinase |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000341500 | - | 1 | 21 | 624_726 | 33.333333333333336 | 1371.0 | Domain | Fibronectin type-III 1 |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000341500 | - | 1 | 21 | 757_842 | 33.333333333333336 | 1371.0 | Domain | Fibronectin type-III 2 |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000341500 | - | 1 | 21 | 853_947 | 33.333333333333336 | 1371.0 | Domain | Fibronectin type-III 3 |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000302850 | - | 1 | 22 | 1104_1110 | 33.333333333333336 | 1383.0 | Nucleotide binding | ATP |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000302850 | - | 1 | 22 | 1163_1164 | 33.333333333333336 | 1383.0 | Nucleotide binding | ATP |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000341500 | - | 1 | 21 | 1104_1110 | 33.333333333333336 | 1371.0 | Nucleotide binding | ATP |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000341500 | - | 1 | 21 | 1163_1164 | 33.333333333333336 | 1371.0 | Nucleotide binding | ATP |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000302850 | - | 1 | 22 | 1361_1364 | 33.333333333333336 | 1383.0 | Region | Note=PIK3R1-binding |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000302850 | - | 1 | 22 | 733_741 | 33.333333333333336 | 1383.0 | Region | Note=Insulin-binding |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000341500 | - | 1 | 21 | 1361_1364 | 33.333333333333336 | 1371.0 | Region | Note=PIK3R1-binding |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000341500 | - | 1 | 21 | 733_741 | 33.333333333333336 | 1371.0 | Region | Note=Insulin-binding |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000302850 | - | 1 | 22 | 28_758 | 33.333333333333336 | 1383.0 | Topological domain | Extracellular |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000302850 | - | 1 | 22 | 763_956 | 33.333333333333336 | 1383.0 | Topological domain | Extracellular |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000302850 | - | 1 | 22 | 980_1382 | 33.333333333333336 | 1383.0 | Topological domain | Cytoplasmic |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000341500 | - | 1 | 21 | 28_758 | 33.333333333333336 | 1371.0 | Topological domain | Extracellular |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000341500 | - | 1 | 21 | 763_956 | 33.333333333333336 | 1371.0 | Topological domain | Extracellular |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000341500 | - | 1 | 21 | 980_1382 | 33.333333333333336 | 1371.0 | Topological domain | Cytoplasmic |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000302850 | - | 1 | 22 | 957_979 | 33.333333333333336 | 1383.0 | Transmembrane | Helical |
Hgene | INSR | chr19:7293803 | chr19:45924651 | ENST00000341500 | - | 1 | 21 | 957_979 | 33.333333333333336 | 1371.0 | Transmembrane | Helical |
Tgene | ERCC1 | chr19:7293803 | chr19:45924651 | ENST00000013807 | 0 | 8 | 17_23 | 35.0 | 324.0 | Motif | Nuclear localization signal | |
Tgene | ERCC1 | chr19:7293803 | chr19:45924651 | ENST00000300853 | 1 | 10 | 17_23 | 35.0 | 298.0 | Motif | Nuclear localization signal | |
Tgene | ERCC1 | chr19:7293803 | chr19:45924651 | ENST00000340192 | 1 | 9 | 17_23 | 35.0 | 274.0 | Motif | Nuclear localization signal | |
Tgene | ERCC1 | chr19:7293803 | chr19:45924651 | ENST00000589165 | 1 | 10 | 17_23 | 35.0 | 298.0 | Motif | Nuclear localization signal |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
INSR | |
ERCC1 |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to INSR-ERCC1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to INSR-ERCC1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |