UTHEALTH HOME    ABOUT SBMI    A-Z    WEBMAIL    INSIDE THE UNIVERSITY
FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Terms of Use

Center for Computational Systems Medicine level1
leaf

Fusion Gene Summary

leaf

Fusion Gene Sample Information

leaf

Fusion ORF Analysis

leaf

Fusion Amino Acid Sequences

leaf

Fusion Protein Functional Features

leaf

Fusion Protein-Protein Interaction

leaf

Related drugs with this fusion protein

leaf

Related disease with this fusion protein

Fusion Protein:KPNA3-MLNR

Fusion Protein Summary

check button Fusion gene summary
Fusion partner gene informationFusion gene name: KPNA3-MLNR
FusionPDB ID: 43382
FusionGDB2.0 ID: 43382
HgeneTgene
Gene symbol

KPNA3

MLNR

Gene ID

3839

2862

Gene namekaryopherin subunit alpha 3motilin receptor
SynonymsIPOA4|SRP1|SRP1gamma|SRP4|hSRP1GPR38|MTLR1
Cytomap

13q14.2

13q14.2

Type of geneprotein-codingprotein-coding
Descriptionimportin subunit alpha-4SRP1-gammaimportin alpha 4importin alpha Q2importin alpha-3importin subunit alpha-3karyopherin alpha 3 (importin alpha 4)qip2motilin receptorG protein-coupled receptor 38
Modification date2020031320200313
UniProtAcc

O00505

.
Ensembl transtripts involved in fusion geneENST idsENST00000261667, ENST00000398307, 
ENST00000218721, 
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0)* DoF score9 X 5 X 7=3152 X 1 X 2=4
# samples 112
** MAII scorelog2(11/315*10)=-1.51784830486262
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/4*10)=2.32192809488736
Context (manual curation of fusion genes in FusionPDB)

PubMed: KPNA3 [Title/Abstract] AND MLNR [Title/Abstract] AND fusion [Title/Abstract]

Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0)KPNA3(50366574)-MLNR(49796176), # samples:1
Anticipated loss of major functional domain due to fusion event.KPNA3-MLNR seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF.
KPNA3-MLNR seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF.
KPNA3-MLNR seems lost the major protein functional domain in Hgene partner, which is a essential gene due to the frame-shifted ORF.
KPNA3-MLNR seems lost the major protein functional domain in Tgene partner, which is a IUPHAR drug target due to the frame-shifted ORF.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check buttonFusion gene breakpoints across KPNA3 (5'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
all structure

check buttonFusion gene breakpoints across MLNR (3'-gene)
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.
all structure


Top

Fusion Gene Sample Information

check buttonFusion gene information from FusionGDB2.0.
check button Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0)
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
SourceDiseaseSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChimerDB4BLCATCGA-UY-A8OB-01AKPNA3chr13

50366574

-MLNRchr13

49796176

+


Top

Fusion ORF Analysis


check buttonFusion information from ORFfinder translation from full-length transcript sequence from FusionPDB.
HenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrandSeq length
(transcript)
BP loci
(transcript)
Predicted start
(transcript)
Predicted stop
(transcript)
Seq length
(amino acids)
ENST00000261667KPNA3chr1350366574-ENST00000218721MLNRchr1349796176+82248447592181

check buttonDeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated.
HenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrandNo-coding scoreCoding score
ENST00000261667ENST00000218721KPNA3chr1350366574-MLNRchr1349796176+0.016814820.98318523

Top

Fusion Amino Acid Sequences


check button For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones.
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP

>43382_43382_1_KPNA3-MLNR_KPNA3_chr13_50366574_ENST00000261667_MLNR_chr13_49796176_ENST00000218721_length(amino acids)=181AA_BP=146
MAQNLQHRGVVESPCRGRGQGHPENQRARIARRTPKPVTAPGHVSPASAAARRSQHRSRPTRPGSRPAPPPALLPPRARRRHRTCSSLPS
PLPLSPSSPSRSKIRRRRRRSRRSSRRRSRAQPWPRTPAWRTTASRASRTRAAMWNGGGSGIYNLLVALPRWQNHLHKHGRFADDVLLSV

--------------------------------------------------------------

Top

Fusion Protein Functional Features


check button Four levels of functional features of fusion genes
Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr13:50366574/chr13:49796176)
- FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels.
- How to search
1. Put your fusion gene symbol.
2. Press the tab key until there will be shown the breakpoint information filled.
4. Go down and press 'Search' tab twice.
4. Go down to have the hyperlink of the search result.
5. Click the hyperlink.
6. See the FGviewer result for your fusion gene.
FGviewer

check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KPNA3

O00505

.
FUNCTION: Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS. Recognizes NLSs of influenza A virus nucleoprotein probably through ARM repeats 7-9.FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

* Minus value of BPloci means that the break pointn is located before the CDS.
- Retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMLNRchr13:50366574chr13:49796176ENST0000021872102321_334300.3333333333333413.0Topological domainExtracellular
TgeneMLNRchr13:50366574chr13:49796176ENST0000021872102359_412300.3333333333333413.0Topological domainCytoplasmic
TgeneMLNRchr13:50366574chr13:49796176ENST0000039830702359_412350.6666666666667387.0Topological domainCytoplasmic
TgeneMLNRchr13:50366574chr13:49796176ENST0000021872102299_320300.3333333333333413.0TransmembraneHelical%3B Name%3D6
TgeneMLNRchr13:50366574chr13:49796176ENST0000021872102335_358300.3333333333333413.0TransmembraneHelical%3B Name%3D7

- Not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKPNA3chr13:50366574chr13:49796176ENST00000261667-1172_5823.0522.0DomainIBB
HgeneKPNA3chr13:50366574chr13:49796176ENST00000261667-11743_5223.0522.0MotifNuclear localization signal
HgeneKPNA3chr13:50366574chr13:49796176ENST00000261667-117137_22923.0522.0RegionNLS binding site (major)
HgeneKPNA3chr13:50366574chr13:49796176ENST00000261667-117306_39423.0522.0RegionNLS binding site (minor)
HgeneKPNA3chr13:50366574chr13:49796176ENST00000261667-117107_14923.0522.0RepeatNote=ARM 2
HgeneKPNA3chr13:50366574chr13:49796176ENST00000261667-117150_19423.0522.0RepeatNote=ARM 3
HgeneKPNA3chr13:50366574chr13:49796176ENST00000261667-117195_23323.0522.0RepeatNote=ARM 4
HgeneKPNA3chr13:50366574chr13:49796176ENST00000261667-117234_27823.0522.0RepeatNote=ARM 5
HgeneKPNA3chr13:50366574chr13:49796176ENST00000261667-117279_31823.0522.0RepeatNote=ARM 6
HgeneKPNA3chr13:50366574chr13:49796176ENST00000261667-117319_36023.0522.0RepeatNote=ARM 7
HgeneKPNA3chr13:50366574chr13:49796176ENST00000261667-117361_40023.0522.0RepeatNote=ARM 8
HgeneKPNA3chr13:50366574chr13:49796176ENST00000261667-117401_44323.0522.0RepeatNote=ARM 9
HgeneKPNA3chr13:50366574chr13:49796176ENST00000261667-117447_48523.0522.0RepeatNote=ARM 10%3B atypical
HgeneKPNA3chr13:50366574chr13:49796176ENST00000261667-11766_10623.0522.0RepeatNote=ARM 1%3B truncated
TgeneMLNRchr13:50366574chr13:49796176ENST0000021872102135_157300.3333333333333413.0Topological domainCytoplasmic
TgeneMLNRchr13:50366574chr13:49796176ENST0000021872102179_246300.3333333333333413.0Topological domainExtracellular
TgeneMLNRchr13:50366574chr13:49796176ENST00000218721021_35300.3333333333333413.0Topological domainExtracellular
TgeneMLNRchr13:50366574chr13:49796176ENST0000021872102271_298300.3333333333333413.0Topological domainCytoplasmic
TgeneMLNRchr13:50366574chr13:49796176ENST000002187210257_74300.3333333333333413.0Topological domainCytoplasmic
TgeneMLNRchr13:50366574chr13:49796176ENST000002187210295_112300.3333333333333413.0Topological domainExtracellular
TgeneMLNRchr13:50366574chr13:49796176ENST0000039830702135_157350.6666666666667387.0Topological domainCytoplasmic
TgeneMLNRchr13:50366574chr13:49796176ENST0000039830702179_246350.6666666666667387.0Topological domainExtracellular
TgeneMLNRchr13:50366574chr13:49796176ENST00000398307021_35350.6666666666667387.0Topological domainExtracellular
TgeneMLNRchr13:50366574chr13:49796176ENST0000039830702271_298350.6666666666667387.0Topological domainCytoplasmic
TgeneMLNRchr13:50366574chr13:49796176ENST0000039830702321_334350.6666666666667387.0Topological domainExtracellular
TgeneMLNRchr13:50366574chr13:49796176ENST000003983070257_74350.6666666666667387.0Topological domainCytoplasmic
TgeneMLNRchr13:50366574chr13:49796176ENST000003983070295_112350.6666666666667387.0Topological domainExtracellular
TgeneMLNRchr13:50366574chr13:49796176ENST0000021872102113_134300.3333333333333413.0TransmembraneHelical%3B Name%3D3
TgeneMLNRchr13:50366574chr13:49796176ENST0000021872102158_178300.3333333333333413.0TransmembraneHelical%3B Name%3D4
TgeneMLNRchr13:50366574chr13:49796176ENST0000021872102247_270300.3333333333333413.0TransmembraneHelical%3B Name%3D5
TgeneMLNRchr13:50366574chr13:49796176ENST000002187210236_56300.3333333333333413.0TransmembraneHelical%3B Name%3D1
TgeneMLNRchr13:50366574chr13:49796176ENST000002187210275_94300.3333333333333413.0TransmembraneHelical%3B Name%3D2
TgeneMLNRchr13:50366574chr13:49796176ENST0000039830702113_134350.6666666666667387.0TransmembraneHelical%3B Name%3D3
TgeneMLNRchr13:50366574chr13:49796176ENST0000039830702158_178350.6666666666667387.0TransmembraneHelical%3B Name%3D4
TgeneMLNRchr13:50366574chr13:49796176ENST0000039830702247_270350.6666666666667387.0TransmembraneHelical%3B Name%3D5
TgeneMLNRchr13:50366574chr13:49796176ENST0000039830702299_320350.6666666666667387.0TransmembraneHelical%3B Name%3D6
TgeneMLNRchr13:50366574chr13:49796176ENST0000039830702335_358350.6666666666667387.0TransmembraneHelical%3B Name%3D7
TgeneMLNRchr13:50366574chr13:49796176ENST000003983070236_56350.6666666666667387.0TransmembraneHelical%3B Name%3D1
TgeneMLNRchr13:50366574chr13:49796176ENST000003983070275_94350.6666666666667387.0TransmembraneHelical%3B Name%3D2


Top

Fusion Protein-Protein Interaction


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page.


check button Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160)
GenePPI interactors


check button Protein-protein interactors based on sequence similarity (STRING)
GeneSTRING network
KPNA3
MLNR


check button - Retained interactions in fusion protein (protein functional feature from UniProt).
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost interactions due to fusion (protein functional feature from UniProt).
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

Related Drugs to KPNA3-MLNR


check button Drugs used for this fusion-positive patient.
(Manual curation of PubMed, 04-30-2022 + MyCancerGenome)
HgeneTgeneDrugSourcePMID

Top

Related Diseases to KPNA3-MLNR


check button Diseases that have this fusion gene.
(Manual curation of PubMed, 04-30-2022 + MyCancerGenome)
HgeneTgeneDiseaseSourcePMID

check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource