UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Fusion Protein:KSR1-NOS2 |
Fusion Protein Summary |
Fusion gene summary |
Fusion partner gene information | Fusion gene name: KSR1-NOS2 | FusionPDB ID: 43722 | FusionGDB2.0 ID: 43722 | Hgene | Tgene | Gene symbol | KSR1 | NOS2 | Gene ID | 8844 | 339345 |
Gene name | kinase suppressor of ras 1 | nanos C2HC-type zinc finger 2 | |
Synonyms | KSR|RSU2 | NOS2|ZC2HC12B | |
Cytomap | 17q11.2 | 19q13.32 | |
Type of gene | protein-coding | protein-coding | |
Description | kinase suppressor of Ras 1 | nanos homolog 2NOS-2 | |
Modification date | 20200327 | 20200313 | |
UniProtAcc | Q8IVT5 | P35228 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000268763, ENST00000319524, ENST00000398988, ENST00000509603, ENST00000578981, ENST00000581975, ENST00000582410, | ENST00000313735, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 10 X 9 X 6=540 | 5 X 4 X 3=60 |
# samples | 10 | 4 | |
** MAII score | log2(10/540*10)=-2.43295940727611 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(4/60*10)=-0.584962500721156 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: KSR1 [Title/Abstract] AND NOS2 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | KSR1(25935036)-NOS2(26086101), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | KSR1-NOS2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. KSR1-NOS2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. KSR1-NOS2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. KSR1-NOS2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | KSR1 | GO:0000185 | activation of MAPKKK activity | 29433126 |
Tgene | NOS2 | GO:0017148 | negative regulation of translation | 24736845 |
Tgene | NOS2 | GO:1900153 | positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay | 24736845 |
Fusion gene breakpoints across KSR1 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across NOS2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | COAD | TCGA-AA-3994-01A | KSR1 | chr17 | 25935036 | + | NOS2 | chr17 | 26086101 | - |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000509603 | KSR1 | chr17 | 25935036 | + | ENST00000313735 | NOS2 | chr17 | 26086101 | - | 2874 | 2091 | 0 | 2393 | 797 |
ENST00000319524 | KSR1 | chr17 | 25935036 | + | ENST00000313735 | NOS2 | chr17 | 26086101 | - | 2940 | 2157 | 0 | 2459 | 819 |
ENST00000268763 | KSR1 | chr17 | 25935036 | + | ENST00000313735 | NOS2 | chr17 | 26086101 | - | 2974 | 2191 | 238 | 2493 | 751 |
ENST00000398988 | KSR1 | chr17 | 25935036 | + | ENST00000313735 | NOS2 | chr17 | 26086101 | - | 2974 | 2191 | 238 | 2493 | 751 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000509603 | ENST00000313735 | KSR1 | chr17 | 25935036 | + | NOS2 | chr17 | 26086101 | - | 0.029520405 | 0.97047955 |
ENST00000319524 | ENST00000313735 | KSR1 | chr17 | 25935036 | + | NOS2 | chr17 | 26086101 | - | 0.026023386 | 0.97397655 |
ENST00000268763 | ENST00000313735 | KSR1 | chr17 | 25935036 | + | NOS2 | chr17 | 26086101 | - | 0.08242519 | 0.91757476 |
ENST00000398988 | ENST00000313735 | KSR1 | chr17 | 25935036 | + | NOS2 | chr17 | 26086101 | - | 0.08242519 | 0.91757476 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >43722_43722_1_KSR1-NOS2_KSR1_chr17_25935036_ENST00000268763_NOS2_chr17_26086101_ENST00000313735_length(amino acids)=751AA_BP=651 MLKGTSSPKAKLVRYICKQRQCKLSVAPGERTPELNSYPRFSDWLYTFNVRPEVVQEIPRDLTLDALLEMNEAKVKETLRRCGASGDECG RLQYALTCLRKVTGLGGEHKEDSSWSSLDARRESGSGPSTDTLSAASLPWPPGSSQLGRAGNSAQGPRSISVSALPASDSPTPSFSEGLS DTCIPLHASGRLTPRALHSFITPPTTPQLRRHTKLKPPRTPPPPSRKVFQLLPSFPTLTRSKSHESQLGNRIDDVSSMRFDLSHGSPQMV RRDIGLSVTHRFSTKSWLSQVCHVCQKSMIFGVKCKHCRLKCHNKCTKEAPACRISFLPLTRLRRTESVPSDINNPVDRAAEPHFGTLPK ALTKKEHPPAMNHLDSSSNPSSTTSSTPSSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPAAYFIHHRQQFIFPVPSAGHCWKCLLIAE SLKENAFNISAFAHAAPLPEAADGTRLDDQPKADVLEAHEAEAEEPEAGKSEAEDDEDEVDDLPSSRRPWRGPISRKASQTSVYLQEWDI PFEQVELGEPIGQGRWGRVHRGRWHGEVAIRLLEMDGHNQDHLKLFKKEVMNYRQTRHENVVLFMGACMNPPHLAIITSFCKGRTLHSFV RDPKTSLDINKTRQIAQEIIKVYVQDILRQQLASEVLRVLHKEPGHLYVCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKR -------------------------------------------------------------- >43722_43722_2_KSR1-NOS2_KSR1_chr17_25935036_ENST00000319524_NOS2_chr17_26086101_ENST00000313735_length(amino acids)=819AA_BP=719 MDRAALRAAAMGEKKEGGGGGDAAAAEGGAGAAASRALQQCGQLQKLIDISIGSLRGLRTKCAVSNDLTQQEIRTLEAKLVRYICKQRQC KLSVAPGERTPELNSYPRFSDWLYTFNVRPEVVQEIPRDLTLDALLEMNEAKVKETLRRCGASGDECGRLQYALTCLRKVTGLGGEHKED SSWSSLDARRESGSGPSTDTLSAASLPWPPGSSQLGRAGNSAQGPRSISVSALPASDSPTPSFSEGLSDTCIPLHASGRLTPRALHSFIT PPTTPQLRRHTKLKPPRTPPPPSRKVFQLLPSFPTLTRSKSHESQLGNRIDDVSSMRFDLSHGSPQMVRRDIGLSVTHRFSTKSWLSQVC HVCQKSMIFGVKCKHCRLKCHNKCTKEAPACRISFLPLTRLRRTESVPSDINNPVDRAAEPHFGTLPKALTKKEHPPAMNHLDSSSNPSS TTSSTPSSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPAAYFIHHRQQFIFPVPSAGHCWKCLLIAESLKENAFNISAFAHAAPLPEAA DGTRLDDQPKADVLEAHEAEAEEPEAGKSEAEDDEDEVDDLPSSRRPWRGPISRKASQTSVYLQEWDIPFEQVELGEPIGQGRWGRVHRG RWHGEVAIRLLEMDGHNQDHLKLFKKEVMNYRQTRHENVVLFMGACMNPPHLAIITSFCKGRTLHSFVRDPKTSLDINKTRQIAQEIIKV YVQDILRQQLASEVLRVLHKEPGHLYVCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDRVAVQ -------------------------------------------------------------- >43722_43722_3_KSR1-NOS2_KSR1_chr17_25935036_ENST00000398988_NOS2_chr17_26086101_ENST00000313735_length(amino acids)=751AA_BP=651 MLKGTSSPKAKLVRYICKQRQCKLSVAPGERTPELNSYPRFSDWLYTFNVRPEVVQEIPRDLTLDALLEMNEAKVKETLRRCGASGDECG RLQYALTCLRKVTGLGGEHKEDSSWSSLDARRESGSGPSTDTLSAASLPWPPGSSQLGRAGNSAQGPRSISVSALPASDSPTPSFSEGLS DTCIPLHASGRLTPRALHSFITPPTTPQLRRHTKLKPPRTPPPPSRKVFQLLPSFPTLTRSKSHESQLGNRIDDVSSMRFDLSHGSPQMV RRDIGLSVTHRFSTKSWLSQVCHVCQKSMIFGVKCKHCRLKCHNKCTKEAPACRISFLPLTRLRRTESVPSDINNPVDRAAEPHFGTLPK ALTKKEHPPAMNHLDSSSNPSSTTSSTPSSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPAAYFIHHRQQFIFPVPSAGHCWKCLLIAE SLKENAFNISAFAHAAPLPEAADGTRLDDQPKADVLEAHEAEAEEPEAGKSEAEDDEDEVDDLPSSRRPWRGPISRKASQTSVYLQEWDI PFEQVELGEPIGQGRWGRVHRGRWHGEVAIRLLEMDGHNQDHLKLFKKEVMNYRQTRHENVVLFMGACMNPPHLAIITSFCKGRTLHSFV RDPKTSLDINKTRQIAQEIIKVYVQDILRQQLASEVLRVLHKEPGHLYVCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKR -------------------------------------------------------------- >43722_43722_4_KSR1-NOS2_KSR1_chr17_25935036_ENST00000509603_NOS2_chr17_26086101_ENST00000313735_length(amino acids)=797AA_BP=697 MDRAALRAAAMGEKKEGGGGGDAAAAEGGAGAAASRALQQCGQLQKLIDISIGSLRGLRTKCAVSNDLTQQEIRTLEAKLVRYICKQRQC KLSVAPGERTPELNSYPRFSDWLYTFNVRPEVVQEIPRDLTLDALLEMNEAKVKETLRRCGASGDECGRLQYALTCLRKVTGLGGEHKED SSWSSLDARRESGSGPSTDTLSAASLPWPPGSSQLGRAGNSAQGPRSISVSALPASDSPTPSFSEGLSDTCIPLHASGRLTPRALHSFIT PPTTPQLRRHTKLKPPRTPPPPSRKVFQLLPSFPTLTRSKSHESQLGNRIDDVSSMRFDLSHGSPQMVRRDIGLSVTHRFSTKSWLSQVC HVCQKSMIFGVKCKHCRLKCHNKCTKEAPACRISFLPLTRLRRTESVPSDINNPVDRAAEPHFGTLPKALTKKEHPPAMNHLDSSSNPSS TTSSTPSSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPAAYFIHHRQQFIFPDISAFAHAAPLPEAADGTRLDDQPKADVLEAHEAEAE EPEAGKSEAEDDEDEVDDLPSSRRPWRGPISRKASQTSVYLQEWDIPFEQVELGEPIGQGRWGRVHRGRWHGEVAIRLLEMDGHNQDHLK LFKKEVMNYRQTRHENVVLFMGACMNPPHLAIITSFCKGRTLHSFVRDPKTSLDINKTRQIAQEIIKVYVQDILRQQLASEVLRVLHKEP -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr17:25935036/chr17:26086101) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
KSR1 | NOS2 |
FUNCTION: Part of a multiprotein signaling complex which promotes phosphorylation of Raf family members and activation of downstream MAP kinases (By similarity). Independently of its kinase activity, acts as MAP2K1/MEK1 and MAP2K2/MEK2-dependent allosteric activator of BRAF; upon binding to MAP2K1/MEK1 or MAP2K2/MEK2, dimerizes with BRAF and promotes BRAF-mediated phosphorylation of MAP2K1/MEK1 and/or MAP2K2/MEK2 (PubMed:29433126). Promotes activation of MAPK1 and/or MAPK3, both in response to EGF and to cAMP (By similarity). Its kinase activity is unsure (By similarity). Some protein kinase activity has been detected in vitro, however the physiological relevance of this activity is unknown (By similarity). {ECO:0000250|UniProtKB:Q61097, ECO:0000269|PubMed:29433126}. | FUNCTION: Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body (PubMed:7531687, PubMed:7544004). In macrophages, NO mediates tumoricidal and bactericidal actions. Also has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such PTGS2/COX2 (By similarity). As component of the iNOS-S100A8/9 transnitrosylase complex involved in the selective inflammatory stimulus-dependent S-nitrosylation of GAPDH on 'Cys-247' implicated in regulation of the GAIT complex activity and probably multiple targets including ANXA5, EZR, MSN and VIM (PubMed:25417112). Involved in inflammation, enhances the synthesis of proinflammatory mediators such as IL6 and IL8 (PubMed:19688109). {ECO:0000250|UniProtKB:P29477, ECO:0000269|PubMed:19688109, ECO:0000269|PubMed:25417112, ECO:0000269|PubMed:7531687, ECO:0000269|PubMed:7544004}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | KSR1 | chr17:25935036 | chr17:26086101 | ENST00000268763 | + | 17 | 22 | 17_21 | 582.0 | 787.0 | Compositional bias | Note=Poly-Gly |
Hgene | KSR1 | chr17:25935036 | chr17:26086101 | ENST00000268763 | + | 17 | 22 | 289_292 | 582.0 | 787.0 | Compositional bias | Note=Poly-Pro |
Hgene | KSR1 | chr17:25935036 | chr17:26086101 | ENST00000268763 | + | 17 | 22 | 1_172 | 582.0 | 787.0 | Region | Mediates association with membranes |
Hgene | KSR1 | chr17:25935036 | chr17:26086101 | ENST00000268763 | + | 17 | 22 | 347_391 | 582.0 | 787.0 | Zinc finger | Phorbol-ester/DAG-type |
Tgene | NOS2 | chr17:25935036 | chr17:26086101 | ENST00000313735 | 24 | 27 | 1076_1091 | 1053.0 | 1154.0 | Nucleotide binding | NADP |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | KSR1 | chr17:25935036 | chr17:26086101 | ENST00000268763 | + | 17 | 22 | 613_883 | 582.0 | 787.0 | Domain | Protein kinase |
Hgene | KSR1 | chr17:25935036 | chr17:26086101 | ENST00000268763 | + | 17 | 22 | 619_627 | 582.0 | 787.0 | Nucleotide binding | ATP |
Tgene | NOS2 | chr17:25935036 | chr17:26086101 | ENST00000313735 | 24 | 27 | 539_677 | 1053.0 | 1154.0 | Domain | Flavodoxin-like | |
Tgene | NOS2 | chr17:25935036 | chr17:26086101 | ENST00000313735 | 24 | 27 | 730_970 | 1053.0 | 1154.0 | Domain | FAD-binding FR-type | |
Tgene | NOS2 | chr17:25935036 | chr17:26086101 | ENST00000313735 | 24 | 27 | 623_654 | 1053.0 | 1154.0 | Nucleotide binding | FMN | |
Tgene | NOS2 | chr17:25935036 | chr17:26086101 | ENST00000313735 | 24 | 27 | 767_778 | 1053.0 | 1154.0 | Nucleotide binding | FAD | |
Tgene | NOS2 | chr17:25935036 | chr17:26086101 | ENST00000313735 | 24 | 27 | 903_913 | 1053.0 | 1154.0 | Nucleotide binding | FAD | |
Tgene | NOS2 | chr17:25935036 | chr17:26086101 | ENST00000313735 | 24 | 27 | 978_996 | 1053.0 | 1154.0 | Nucleotide binding | NADP | |
Tgene | NOS2 | chr17:25935036 | chr17:26086101 | ENST00000313735 | 24 | 27 | 509_529 | 1053.0 | 1154.0 | Region | Calmodulin-binding |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
Gene | STRING network |
KSR1 | |
NOS2 |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to KSR1-NOS2 |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to KSR1-NOS2 |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |