UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
Fusion Protein:ABI2-CARF |
Fusion Protein Summary |
Fusion gene summary |
Fusion partner gene information | Fusion gene name: ABI2-CARF | FusionPDB ID: 455 | FusionGDB2.0 ID: 455 | Hgene | Tgene | Gene symbol | ABI2 | CARF | Gene ID | 10152 | 79800 |
Gene name | abl interactor 2 | calcium responsive transcription factor | |
Synonyms | ABI-2|ABI2B|AIP-1|AIP1|AblBP3|SSH3BP2|argBP1|argBPIA|argBPIB | ALS2CR8|NYD-SP24 | |
Cytomap | 2q33.2 | 2q33.2 | |
Type of gene | protein-coding | protein-coding | |
Description | abl interactor 2abelson interactor 2abl binding protein 3abl-interacting protein 1 (SH3-containing protein)abl-interactor protein 2barg protein tyrosine kinase-binding proteinarg-binding protein 1 | calcium-responsive transcription factoramyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 8amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8 proteincalcium-response factortestis development protein NYD-SP24 | |
Modification date | 20200327 | 20200313 | |
UniProtAcc | Q9NYB9 | Q8N187 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000430574, ENST00000261016, ENST00000261017, ENST00000261018, ENST00000295851, ENST00000422511, ENST00000424558, ENST00000430418, | ENST00000402905, ENST00000320443, ENST00000414439, ENST00000428585, ENST00000434998, ENST00000438828, ENST00000444724, ENST00000456821, ENST00000471271, ENST00000545253, ENST00000545262, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 14 X 7 X 8=784 | 3 X 4 X 3=36 |
# samples | 17 | 4 | |
** MAII score | log2(17/784*10)=-2.20531890797751 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(4/36*10)=0.15200309344505 effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs). DoF>8 and MAII>0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: ABI2 [Title/Abstract] AND CARF [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | ABI2(204267457)-CARF(203846278), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | ABI2-CARF seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ABI2-CARF seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. ABI2-CARF seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. ABI2-CARF seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
Partner | Gene | GO ID | GO term | PubMed ID |
Hgene | ABI2 | GO:0016601 | Rac protein signal transduction | 21107423 |
Hgene | ABI2 | GO:0018108 | peptidyl-tyrosine phosphorylation | 17101133 |
Hgene | ABI2 | GO:2000601 | positive regulation of Arp2/3 complex-mediated actin nucleation | 21107423 |
Tgene | CARF | GO:0035865 | cellular response to potassium ion | 22174809 |
Tgene | CARF | GO:0061400 | positive regulation of transcription from RNA polymerase II promoter in response to calcium ion | 11832226|22174809 |
Tgene | CARF | GO:0071277 | cellular response to calcium ion | 11832226|22174809 |
Fusion gene breakpoints across ABI2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Fusion gene breakpoints across CARF (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
Top |
Fusion Gene Sample Information |
Fusion gene information from FusionGDB2.0. |
Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | BRCA | TCGA-AN-A0FJ-01A | ABI2 | chr2 | 204267457 | + | CARF | chr2 | 203846278 | + |
Top |
Fusion ORF Analysis |
Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000295851 | ABI2 | chr2 | 204267457 | + | ENST00000402905 | CARF | chr2 | 203846278 | + | 5547 | 1488 | 263 | 2107 | 614 |
ENST00000261017 | ABI2 | chr2 | 204267457 | + | ENST00000402905 | CARF | chr2 | 203846278 | + | 5285 | 1226 | 202 | 1845 | 547 |
ENST00000430418 | ABI2 | chr2 | 204267457 | + | ENST00000402905 | CARF | chr2 | 203846278 | + | 5209 | 1150 | 90 | 1769 | 559 |
ENST00000424558 | ABI2 | chr2 | 204267457 | + | ENST00000402905 | CARF | chr2 | 203846278 | + | 5353 | 1294 | 87 | 1913 | 608 |
ENST00000261016 | ABI2 | chr2 | 204267457 | + | ENST00000402905 | CARF | chr2 | 203846278 | + | 5246 | 1187 | 331 | 1806 | 491 |
ENST00000422511 | ABI2 | chr2 | 204267457 | + | ENST00000402905 | CARF | chr2 | 203846278 | + | 5183 | 1124 | 31 | 1743 | 570 |
ENST00000261018 | ABI2 | chr2 | 204267457 | + | ENST00000402905 | CARF | chr2 | 203846278 | + | 4656 | 597 | 17 | 1216 | 399 |
DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000295851 | ENST00000402905 | ABI2 | chr2 | 204267457 | + | CARF | chr2 | 203846278 | + | 0.000171867 | 0.9998281 |
ENST00000261017 | ENST00000402905 | ABI2 | chr2 | 204267457 | + | CARF | chr2 | 203846278 | + | 5.64E-05 | 0.9999436 |
ENST00000430418 | ENST00000402905 | ABI2 | chr2 | 204267457 | + | CARF | chr2 | 203846278 | + | 6.65E-05 | 0.9999335 |
ENST00000424558 | ENST00000402905 | ABI2 | chr2 | 204267457 | + | CARF | chr2 | 203846278 | + | 8.57E-05 | 0.9999143 |
ENST00000261016 | ENST00000402905 | ABI2 | chr2 | 204267457 | + | CARF | chr2 | 203846278 | + | 8.29E-05 | 0.99991715 |
ENST00000422511 | ENST00000402905 | ABI2 | chr2 | 204267457 | + | CARF | chr2 | 203846278 | + | 0.000143657 | 0.99985635 |
ENST00000261018 | ENST00000402905 | ABI2 | chr2 | 204267457 | + | CARF | chr2 | 203846278 | + | 0.00026302 | 0.99973696 |
Top |
Fusion Amino Acid Sequences |
For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >455_455_1_ABI2-CARF_ABI2_chr2_204267457_ENST00000261016_CARF_chr2_203846278_ENST00000402905_length(amino acids)=491AA_BP=283 MSCRCWISRHPSYEGWNLQSIIFHKQIRGVDLESTFVTKFGNNCSLRLNETVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVR YIRKPIDYTILDDIGHGVKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPSQQSPVRT ASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPGHPVQFYSMNRPASRHTPPTIGGSLPYRRPPSITSQTS LQNQMNGGPFYSQNPGNSPGESITTKVETNQTRGSLSPEPTHLLSSLSSFQPKIFTQLQGLQLQPRYTSPDESPAVVSVNNQPSSSPSGL LDTIGSAVMNNNSLLLGQSHSLQRDTCLTQNNSTASTMGNLPEPDQNLVAMDELVEVGDVEDTGNLEGTVHRILLGDVQTIPIQIIDNHS -------------------------------------------------------------- >455_455_2_ABI2-CARF_ABI2_chr2_204267457_ENST00000261017_CARF_chr2_203846278_ENST00000402905_length(amino acids)=547AA_BP=339 MYEEEEEEDVKMAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQ ASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKVSTQNMKMGGLPRTT PPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSG SVGVPIAVPTPSPPSVFPGHPVQFYSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNPGNSPGESITTKVETNQTRG SLSPEPTHLLSSLSSFQPKIFTQLQGLQLQPRYTSPDESPAVVSVNNQPSSSPSGLLDTIGSAVMNNNSLLLGQSHSLQRDTCLTQNNST ASTMGNLPEPDQNLVAMDELVEVGDVEDTGNLEGTVHRILLGDVQTIPIQIIDNHSALIEENPESTISVSQVKQEPKEPALSMEAKKTVD -------------------------------------------------------------- >455_455_3_ABI2-CARF_ABI2_chr2_204267457_ENST00000261018_CARF_chr2_203846278_ENST00000402905_length(amino acids)=399AA_BP=191 MLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPAPAGSAGTPPL PATSASAPAPLVPATVPSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQ NQMNGGPFYSQNPGNSPGESITTKVETNQTRGSLSPEPTHLLSSLSSFQPKIFTQLQGLQLQPRYTSPDESPAVVSVNNQPSSSPSGLLD TIGSAVMNNNSLLLGQSHSLQRDTCLTQNNSTASTMGNLPEPDQNLVAMDELVEVGDVEDTGNLEGTVHRILLGDVQTIPIQIIDNHSAL -------------------------------------------------------------- >455_455_4_ABI2-CARF_ABI2_chr2_204267457_ENST00000295851_CARF_chr2_203846278_ENST00000402905_length(amino acids)=614AA_BP=406 MYEEEEEEDVKMAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQ ASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMG GLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSR ENSGSGSVGVPIAVPTPSPPSVFPAPAGSAGTPPLPATSASAPAPLVPATVPSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQ FYSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNPGNSPGESITTKVETNQTRGSLSPEPTHLLSSLSSFQPKIFTQ LQGLQLQPRYTSPDESPAVVSVNNQPSSSPSGLLDTIGSAVMNNNSLLLGQSHSLQRDTCLTQNNSTASTMGNLPEPDQNLVAMDELVEV -------------------------------------------------------------- >455_455_5_ABI2-CARF_ABI2_chr2_204267457_ENST00000422511_CARF_chr2_203846278_ENST00000402905_length(amino acids)=570AA_BP=362 MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLRRMESSI NHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQK PPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSVGVP IAVPTPSPPSVFPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFY SQNPGNSPGESITTKVETNQTRGSLSPEPTHLLSSLSSFQPKIFTQLQGLQLQPRYTSPDESPAVVSVNNQPSSSPSGLLDTIGSAVMNN NSLLLGQSHSLQRDTCLTQNNSTASTMGNLPEPDQNLVAMDELVEVGDVEDTGNLEGTVHRILLGDVQTIPIQIIDNHSALIEENPESTI -------------------------------------------------------------- >455_455_6_ABI2-CARF_ABI2_chr2_204267457_ENST00000424558_CARF_chr2_203846278_ENST00000402905_length(amino acids)=608AA_BP=400 MYEEEEEEDVKMAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQ ASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKVSTQNMKMGGLPRTT PPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSG SVGVPIAVPTPSPPSVFPAPAGSAGTPPLPATSASAPAPLVPATVPSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNR PASRHTPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNPGNSPGESITTKVETNQTRGSLSPEPTHLLSSLSSFQPKIFTQLQGLQL QPRYTSPDESPAVVSVNNQPSSSPSGLLDTIGSAVMNNNSLLLGQSHSLQRDTCLTQNNSTASTMGNLPEPDQNLVAMDELVEVGDVEDT -------------------------------------------------------------- >455_455_7_ABI2-CARF_ABI2_chr2_204267457_ENST00000430418_CARF_chr2_203846278_ENST00000402905_length(amino acids)=559AA_BP=351 MYEEEEEEDVKMAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQ ASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKVSTQNMKMGGLPRTT PPTQKPPSPPMSGKGTLGSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPAPAGSAGTPPLPATSASAPAPLVPATVPSST APDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNPGNSPGES ITTKVETNQTRGSLSPEPTHLLSSLSSFQPKIFTQLQGLQLQPRYTSPDESPAVVSVNNQPSSSPSGLLDTIGSAVMNNNSLLLGQSHSL QRDTCLTQNNSTASTMGNLPEPDQNLVAMDELVEVGDVEDTGNLEGTVHRILLGDVQTIPIQIIDNHSALIEENPESTISVSQVKQEPKE -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr2:204267457/chr2:203846278) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
Main function of each fusion partner protein. (from UniProt) |
Hgene | Tgene |
ABI2 | CARF |
FUNCTION: Regulator of actin cytoskeleton dynamics underlying cell motility and adhesion. Functions as a component of the WAVE complex, which activates actin nucleating machinery Arp2/3 to drive lamellipodia formation (PubMed:21107423). Acts as regulator and substrate of nonreceptor tyrosine kinases ABL1 and ABL2 involved in processes linked to cell growth and differentiation. Positively regulates ABL1-mediated phosphorylation of ENAH, which is required for proper polymerization of nucleated actin filaments at the leading edge (PubMed:7590236, PubMed:8649853, PubMed:10498863). Contributes to the regulation of actin assembly at the tips of neuron projections. In particular, controls dendritic spine morphogenesis and may promote dendritic spine specification toward large mushroom-type spines known as repositories of memory in the brain (By similarity). In hippocampal neurons, may mediate actin-dependent BDNF-NTRK2 early endocytic trafficking that triggers dendrite outgrowth (By similarity). Participates in ocular lens morphogenesis, likely by regulating lamellipodia-driven adherens junction formation at the epithelial cell-secondary lens fiber interface (By similarity). Also required for nascent adherens junction assembly in epithelial cells (PubMed:15572692). {ECO:0000250|UniProtKB:P62484, ECO:0000269|PubMed:10498863, ECO:0000269|PubMed:15572692, ECO:0000269|PubMed:21107423, ECO:0000269|PubMed:7590236, ECO:0000269|PubMed:8649853}. | FUNCTION: Acts as a transcriptional activator that mediates the calcium- and neuron-selective induction of BDNF exon III transcription. Binds to the consensus calcium-response element CaRE1 5'-CTATTTCGAG-3' sequence. {ECO:0000269|PubMed:11832226, ECO:0000269|PubMed:22174809}. |
Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ABI2 | chr2:204267457 | chr2:203846278 | ENST00000261016 | + | 8 | 10 | 45_107 | 285.3333333333333 | 402.0 | Domain | t-SNARE coiled-coil homology |
Hgene | ABI2 | chr2:204267457 | chr2:203846278 | ENST00000261017 | + | 7 | 10 | 45_107 | 330.3333333333333 | 476.0 | Domain | t-SNARE coiled-coil homology |
Hgene | ABI2 | chr2:204267457 | chr2:203846278 | ENST00000424558 | + | 8 | 10 | 45_107 | 391.3333333333333 | 508.0 | Domain | t-SNARE coiled-coil homology |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | ABI2 | chr2:204267457 | chr2:203846278 | ENST00000261016 | + | 8 | 10 | 172_423 | 285.3333333333333 | 402.0 | Compositional bias | Note=Pro-rich |
Hgene | ABI2 | chr2:204267457 | chr2:203846278 | ENST00000261017 | + | 7 | 10 | 172_423 | 330.3333333333333 | 476.0 | Compositional bias | Note=Pro-rich |
Hgene | ABI2 | chr2:204267457 | chr2:203846278 | ENST00000424558 | + | 8 | 10 | 172_423 | 391.3333333333333 | 508.0 | Compositional bias | Note=Pro-rich |
Hgene | ABI2 | chr2:204267457 | chr2:203846278 | ENST00000261016 | + | 8 | 10 | 451_510 | 285.3333333333333 | 402.0 | Domain | SH3 |
Hgene | ABI2 | chr2:204267457 | chr2:203846278 | ENST00000261017 | + | 7 | 10 | 451_510 | 330.3333333333333 | 476.0 | Domain | SH3 |
Hgene | ABI2 | chr2:204267457 | chr2:203846278 | ENST00000424558 | + | 8 | 10 | 451_510 | 391.3333333333333 | 508.0 | Domain | SH3 |
Top |
Fusion Protein-Protein Interaction |
Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
Gene | PPI interactors |
Protein-protein interactors based on sequence similarity (STRING) |
Gene | STRING network |
ABI2 | |
CARF |
- Retained interactions in fusion protein (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
- Lost interactions due to fusion (protein functional feature from UniProt). |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to ABI2-CARF |
Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to ABI2-CARF |
Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
Diseases associated with fusion partners. (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |