| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:MAPK14-EHMT1 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: MAPK14-EHMT1 | FusionPDB ID: 51517 | FusionGDB2.0 ID: 51517 | Hgene | Tgene | Gene symbol | MAPK14 | EHMT1 | Gene ID | 1432 | 79813 |
| Gene name | mitogen-activated protein kinase 14 | euchromatic histone lysine methyltransferase 1 | |
| Synonyms | CSBP|CSBP1|CSBP2|CSPB1|EXIP|Mxi2|PRKM14|PRKM15|RK|SAPK2A|p38|p38ALPHA | EHMT1-IT1|EUHMTASE1|Eu-HMTase1|FP13812|GLP|GLP1|KLEFS1|KMT1D | |
| Cytomap | 6p21.31 | 9q34.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | mitogen-activated protein kinase 14CSAID-binding proteinMAP kinase 14MAP kinase Mxi2MAP kinase p38 alphaMAX-interacting protein 2cytokine suppressive anti-inflammatory drug binding proteinmitogen-activated protein kinase p38 alphap38 MAP kinasep3 | histone-lysine N-methyltransferase EHMT1EHMT1 intronic transcript 1G9a-like protein 1H3-K9-HMTase 5euchromatic histone-lysine N-methyltransferase 1histone H3-K9 methyltransferase 5histone-lysine N-methyltransferase, H3 lysine-9 specific 5lysine N-m | |
| Modification date | 20200329 | 20200313 | |
| UniProtAcc | Q16539 | Q9H9B1 | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000229794, ENST00000310795, ENST00000468133, ENST00000229795, | ENST00000334856, ENST00000460843, ENST00000371394, ENST00000462484, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 7 X 6 X 5=210 | 15 X 14 X 10=2100 |
| # samples | 7 | 21 | |
| ** MAII score | log2(7/210*10)=-1.58496250072116 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(21/2100*10)=-3.32192809488736 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: MAPK14 [Title/Abstract] AND EHMT1 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | MAPK14(36063843)-EHMT1(140605419), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | MAPK14-EHMT1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MAPK14-EHMT1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MAPK14-EHMT1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. MAPK14-EHMT1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | MAPK14 | GO:0035556 | intracellular signal transduction | 10838079 |
| Hgene | MAPK14 | GO:0071222 | cellular response to lipopolysaccharide | 23776175 |
| Hgene | MAPK14 | GO:1900015 | regulation of cytokine production involved in inflammatory response | 15251176 |
| Tgene | EHMT1 | GO:0006325 | chromatin organization | 12004135 |
| Tgene | EHMT1 | GO:0016571 | histone methylation | 12004135 |
| Tgene | EHMT1 | GO:0018027 | peptidyl-lysine dimethylation | 20118233 |
| Fusion gene breakpoints across MAPK14 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across EHMT1 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | SARC | TCGA-3B-A9HL-01A | MAPK14 | chr6 | 36063843 | - | EHMT1 | chr9 | 140605419 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000229794 | MAPK14 | chr6 | 36063843 | - | ENST00000462484 | EHMT1 | chr9 | 140605419 | + | 3799 | 1150 | 163 | 3555 | 1130 |
| ENST00000468133 | MAPK14 | chr6 | 36063843 | - | ENST00000462484 | EHMT1 | chr9 | 140605419 | + | 3481 | 832 | 106 | 3237 | 1043 |
| ENST00000310795 | MAPK14 | chr6 | 36063843 | - | ENST00000462484 | EHMT1 | chr9 | 140605419 | + | 3411 | 762 | 0 | 3167 | 1055 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000229794 | ENST00000462484 | MAPK14 | chr6 | 36063843 | - | EHMT1 | chr9 | 140605419 | + | 0.00329177 | 0.99670815 |
| ENST00000468133 | ENST00000462484 | MAPK14 | chr6 | 36063843 | - | EHMT1 | chr9 | 140605419 | + | 0.003291057 | 0.99670887 |
| ENST00000310795 | ENST00000462484 | MAPK14 | chr6 | 36063843 | - | EHMT1 | chr9 | 140605419 | + | 0.002203504 | 0.99779654 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >51517_51517_1_MAPK14-EHMT1_MAPK14_chr6_36063843_ENST00000229794_EHMT1_chr9_140605419_ENST00000462484_length(amino acids)=1130AA_BP=329 MPLAGLAPVAGAHPAAAADSSRARGSLRGRGSRTCAGDQRKVPARLGGQQGPGRGCGCRRGPHRATFLPGGCRWKMSQERPTFYRQELNK TIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLV THLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIML NWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESAVPARGEPQQDCCVKTELLGEETPMAADEGS AEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGYILN KPALQAQPLRTTSTLASSLPGHAAKTLPGGAGKGRTPSAFPQTPAAPPATLGEGSADTEDRKLPAPGADVKVHRARKTMPKSVVGLHAAS KDPREVREARDHKEPKEEINKNISDFGRQQLLPPFPSLHQSLPQNQCYMATTKSQTACLPFVLAAAVSRKKKRRMGTYSLVPKKKTKVLK QRTVIEMFKSITHSTVGSKGEKDLGASSLHVNGESLEMDSDEDDSEELEEDDGHGAEQAAAFPTEDSRTSKESMSEADRAQKMDGESEEE QESVDTGEEEEGGDESDLSSESSIKKKFLKRKGKTDSPWIKPARKRRRRSRKKPSGALGSESYKSSAGSAEQTAPGDSTGYMEVSLDSLD LRVKGILSSQAEGLANGPDVLETDGLQEVPLCSCRMETPKSREITTLANNQCMATESVDHELGRCTNSVVKYELMRPSNKAPLLVLCEDH RGRMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASRVNNASYCPHCGEESSKAKEVTIAKADTTSTVTPVPGQEKGSALEGRAD TTTGSAAGPPLSEDDKLQGAASHVPEGFDPTGPAGLGRPTPGLSQGPGKETLESALIALDSEKPKKLRFHPKQLYFSARQGELQKVLLML -------------------------------------------------------------- >51517_51517_2_MAPK14-EHMT1_MAPK14_chr6_36063843_ENST00000310795_EHMT1_chr9_140605419_ENST00000462484_length(amino acids)=1055AA_BP=254 MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVF TPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESAVPARGEPQQDCCVKT ELLGEETPMAADEGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADD FVQTSVIGSNGYILNKPALQAQPLRTTSTLASSLPGHAAKTLPGGAGKGRTPSAFPQTPAAPPATLGEGSADTEDRKLPAPGADVKVHRA RKTMPKSVVGLHAASKDPREVREARDHKEPKEEINKNISDFGRQQLLPPFPSLHQSLPQNQCYMATTKSQTACLPFVLAAAVSRKKKRRM GTYSLVPKKKTKVLKQRTVIEMFKSITHSTVGSKGEKDLGASSLHVNGESLEMDSDEDDSEELEEDDGHGAEQAAAFPTEDSRTSKESMS EADRAQKMDGESEEEQESVDTGEEEEGGDESDLSSESSIKKKFLKRKGKTDSPWIKPARKRRRRSRKKPSGALGSESYKSSAGSAEQTAP GDSTGYMEVSLDSLDLRVKGILSSQAEGLANGPDVLETDGLQEVPLCSCRMETPKSREITTLANNQCMATESVDHELGRCTNSVVKYELM RPSNKAPLLVLCEDHRGRMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASRVNNASYCPHCGEESSKAKEVTIAKADTTSTVTP VPGQEKGSALEGRADTTTGSAAGPPLSEDDKLQGAASHVPEGFDPTGPAGLGRPTPGLSQGPGKETLESALIALDSEKPKKLRFHPKQLY -------------------------------------------------------------- >51517_51517_3_MAPK14-EHMT1_MAPK14_chr6_36063843_ENST00000468133_EHMT1_chr9_140605419_ENST00000462484_length(amino acids)=1043AA_BP=242 MNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDV YLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPE IMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESAVPARGEPQQDCCVKTELLGEETPMAAD EGSAEKQAGEAHMAADGETNGSCENSDASSHANAAKHTQDSARVNPQDGTNTLTRIAENGVSERDSEAAKQNHVTADDFVQTSVIGSNGY ILNKPALQAQPLRTTSTLASSLPGHAAKTLPGGAGKGRTPSAFPQTPAAPPATLGEGSADTEDRKLPAPGADVKVHRARKTMPKSVVGLH AASKDPREVREARDHKEPKEEINKNISDFGRQQLLPPFPSLHQSLPQNQCYMATTKSQTACLPFVLAAAVSRKKKRRMGTYSLVPKKKTK VLKQRTVIEMFKSITHSTVGSKGEKDLGASSLHVNGESLEMDSDEDDSEELEEDDGHGAEQAAAFPTEDSRTSKESMSEADRAQKMDGES EEEQESVDTGEEEEGGDESDLSSESSIKKKFLKRKGKTDSPWIKPARKRRRRSRKKPSGALGSESYKSSAGSAEQTAPGDSTGYMEVSLD SLDLRVKGILSSQAEGLANGPDVLETDGLQEVPLCSCRMETPKSREITTLANNQCMATESVDHELGRCTNSVVKYELMRPSNKAPLLVLC EDHRGRMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASRVNNASYCPHCGEESSKAKEVTIAKADTTSTVTPVPGQEKGSALEG RADTTTGSAAGPPLSEDDKLQGAASHVPEGFDPTGPAGLGRPTPGLSQGPGKETLESALIALDSEKPKKLRFHPKQLYFSARQGELQKVL -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr6:36063843/chr9:140605419) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| MAPK14 | EHMT1 |
| FUNCTION: Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK14 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. Some of the targets are downstream kinases which are activated through phosphorylation and further phosphorylate additional targets. RPS6KA5/MSK1 and RPS6KA4/MSK2 can directly phosphorylate and activate transcription factors such as CREB1, ATF1, the NF-kappa-B isoform RELA/NFKB3, STAT1 and STAT3, but can also phosphorylate histone H3 and the nucleosomal protein HMGN1. RPS6KA5/MSK1 and RPS6KA4/MSK2 play important roles in the rapid induction of immediate-early genes in response to stress or mitogenic stimuli, either by inducing chromatin remodeling or by recruiting the transcription machinery. On the other hand, two other kinase targets, MAPKAPK2/MK2 and MAPKAPK3/MK3, participate in the control of gene expression mostly at the post-transcriptional level, by phosphorylating ZFP36 (tristetraprolin) and ELAVL1, and by regulating EEF2K, which is important for the elongation of mRNA during translation. MKNK1/MNK1 and MKNK2/MNK2, two other kinases activated by p38 MAPKs, regulate protein synthesis by phosphorylating the initiation factor EIF4E2. MAPK14 interacts also with casein kinase II, leading to its activation through autophosphorylation and further phosphorylation of TP53/p53. In the cytoplasm, the p38 MAPK pathway is an important regulator of protein turnover. For example, CFLAR is an inhibitor of TNF-induced apoptosis whose proteasome-mediated degradation is regulated by p38 MAPK phosphorylation. In a similar way, MAPK14 phosphorylates the ubiquitin ligase SIAH2, regulating its activity towards EGLN3. MAPK14 may also inhibit the lysosomal degradation pathway of autophagy by interfering with the intracellular trafficking of the transmembrane protein ATG9. Another function of MAPK14 is to regulate the endocytosis of membrane receptors by different mechanisms that impinge on the small GTPase RAB5A. In addition, clathrin-mediated EGFR internalization induced by inflammatory cytokines and UV irradiation depends on MAPK14-mediated phosphorylation of EGFR itself as well as of RAB5A effectors. Ectodomain shedding of transmembrane proteins is regulated by p38 MAPKs as well. In response to inflammatory stimuli, p38 MAPKs phosphorylate the membrane-associated metalloprotease ADAM17. Such phosphorylation is required for ADAM17-mediated ectodomain shedding of TGF-alpha family ligands, which results in the activation of EGFR signaling and cell proliferation. Another p38 MAPK substrate is FGFR1. FGFR1 can be translocated from the extracellular space into the cytosol and nucleus of target cells, and regulates processes such as rRNA synthesis and cell growth. FGFR1 translocation requires p38 MAPK activation. In the nucleus, many transcription factors are phosphorylated and activated by p38 MAPKs in response to different stimuli. Classical examples include ATF1, ATF2, ATF6, ELK1, PTPRH, DDIT3, TP53/p53 and MEF2C and MEF2A. The p38 MAPKs are emerging as important modulators of gene expression by regulating chromatin modifiers and remodelers. The promoters of several genes involved in the inflammatory response, such as IL6, IL8 and IL12B, display a p38 MAPK-dependent enrichment of histone H3 phosphorylation on 'Ser-10' (H3S10ph) in LPS-stimulated myeloid cells. This phosphorylation enhances the accessibility of the cryptic NF-kappa-B-binding sites marking promoters for increased NF-kappa-B recruitment. Phosphorylates CDC25B and CDC25C which is required for binding to 14-3-3 proteins and leads to initiation of a G2 delay after ultraviolet radiation. Phosphorylates TIAR following DNA damage, releasing TIAR from GADD45A mRNA and preventing mRNA degradation. The p38 MAPKs may also have kinase-independent roles, which are thought to be due to the binding to targets in the absence of phosphorylation. Protein O-Glc-N-acylation catalyzed by the OGT is regulated by MAPK14, and, although OGT does not seem to be phosphorylated by MAPK14, their interaction increases upon MAPK14 activation induced by glucose deprivation. This interaction may regulate OGT activity by recruiting it to specific targets such as neurofilament H, stimulating its O-Glc-N-acylation. Required in mid-fetal development for the growth of embryo-derived blood vessels in the labyrinth layer of the placenta. Also plays an essential role in developmental and stress-induced erythropoiesis, through regulation of EPO gene expression. Isoform MXI2 activation is stimulated by mitogens and oxidative stress and only poorly phosphorylates ELK1 and ATF2. Isoform EXIP may play a role in the early onset of apoptosis. Phosphorylates S100A9 at 'Thr-113'. {ECO:0000269|PubMed:10330143, ECO:0000269|PubMed:10747897, ECO:0000269|PubMed:10943842, ECO:0000269|PubMed:11154262, ECO:0000269|PubMed:11333986, ECO:0000269|PubMed:15905572, ECO:0000269|PubMed:16932740, ECO:0000269|PubMed:17003045, ECO:0000269|PubMed:17724032, ECO:0000269|PubMed:19893488, ECO:0000269|PubMed:20188673, ECO:0000269|PubMed:20932473, ECO:0000269|PubMed:9430721, ECO:0000269|PubMed:9687510, ECO:0000269|PubMed:9792677, ECO:0000269|PubMed:9858528}.; FUNCTION: (Microbial infection) Activated by phosphorylation by M.tuberculosis EsxA in T-cells leading to inhibition of IFN-gamma production; phosphorylation is apparent within 15 minute and is inhibited by kinase-specific inhibitors SB203580 and siRNA (PubMed:21586573). {ECO:0000269|PubMed:21586573}. | FUNCTION: Histone methyltransferase that specifically mono- and dimethylates 'Lys-9' of histone H3 (H3K9me1 and H3K9me2, respectively) in euchromatin. H3K9me represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. Also weakly methylates 'Lys-27' of histone H3 (H3K27me). Also required for DNA methylation, the histone methyltransferase activity is not required for DNA methylation, suggesting that these 2 activities function independently. Probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1. During G0 phase, it probably contributes to silencing of MYC- and E2F-responsive genes, suggesting a role in G0/G1 transition in cell cycle. In addition to the histone methyltransferase activity, also methylates non-histone proteins: mediates dimethylation of 'Lys-373' of p53/TP53. Represses the expression of mitochondrial function-related genes, perhaps by occupying their promoter regions, working in concert with probable chromatin reader BAZ2B (By similarity). {ECO:0000250|UniProtKB:Q5DW34, ECO:0000269|PubMed:12004135, ECO:0000269|PubMed:20118233}. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | MAPK14 | chr6:36063843 | chr9:140605419 | ENST00000229794 | - | 9 | 12 | 30_38 | 254.0 | 361.0 | Nucleotide binding | Note=ATP |
| Hgene | MAPK14 | chr6:36063843 | chr9:140605419 | ENST00000310795 | - | 9 | 11 | 30_38 | 254.0 | 312.6666666666667 | Nucleotide binding | Note=ATP |
| Hgene | MAPK14 | chr6:36063843 | chr9:140605419 | ENST00000229794 | - | 9 | 12 | 106_110 | 254.0 | 361.0 | Region | Note=Inhibitor-binding |
| Hgene | MAPK14 | chr6:36063843 | chr9:140605419 | ENST00000229794 | - | 9 | 12 | 168_169 | 254.0 | 361.0 | Region | Note=Inhibitor-binding |
| Hgene | MAPK14 | chr6:36063843 | chr9:140605419 | ENST00000229794 | - | 9 | 12 | 70_71 | 254.0 | 361.0 | Region | Note=Inhibitor-binding |
| Hgene | MAPK14 | chr6:36063843 | chr9:140605419 | ENST00000310795 | - | 9 | 11 | 106_110 | 254.0 | 312.6666666666667 | Region | Note=Inhibitor-binding |
| Hgene | MAPK14 | chr6:36063843 | chr9:140605419 | ENST00000310795 | - | 9 | 11 | 168_169 | 254.0 | 312.6666666666667 | Region | Note=Inhibitor-binding |
| Hgene | MAPK14 | chr6:36063843 | chr9:140605419 | ENST00000310795 | - | 9 | 11 | 70_71 | 254.0 | 312.6666666666667 | Region | Note=Inhibitor-binding |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 1292_1295 | 0 | 826.0 | Compositional bias | Note=Poly-Ala | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 406_409 | 0 | 826.0 | Compositional bias | Note=Poly-Glu | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 442_449 | 0 | 826.0 | Compositional bias | Note=Poly-Arg | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 1292_1295 | 7.0 | 1299.0 | Compositional bias | Note=Poly-Ala | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 406_409 | 7.0 | 1299.0 | Compositional bias | Note=Poly-Glu | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 442_449 | 7.0 | 1299.0 | Compositional bias | Note=Poly-Arg | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 1292_1295 | 7.0 | 809.0 | Compositional bias | Note=Poly-Ala | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 406_409 | 7.0 | 809.0 | Compositional bias | Note=Poly-Glu | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 442_449 | 7.0 | 809.0 | Compositional bias | Note=Poly-Arg | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 1060_1123 | 0 | 826.0 | Domain | Pre-SET | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 1126_1243 | 0 | 826.0 | Domain | SET | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 1060_1123 | 7.0 | 1299.0 | Domain | Pre-SET | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 1126_1243 | 7.0 | 1299.0 | Domain | SET | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 1060_1123 | 7.0 | 809.0 | Domain | Pre-SET | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 1126_1243 | 7.0 | 809.0 | Domain | SET | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 1136_1138 | 0 | 826.0 | Region | Note=S-adenosyl-L-methionine binding | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 1200_1201 | 0 | 826.0 | Region | Note=S-adenosyl-L-methionine binding | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 905_907 | 0 | 826.0 | Region | Note=Histone H3K9me binding | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 1136_1138 | 7.0 | 1299.0 | Region | Note=S-adenosyl-L-methionine binding | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 1200_1201 | 7.0 | 1299.0 | Region | Note=S-adenosyl-L-methionine binding | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 905_907 | 7.0 | 1299.0 | Region | Note=Histone H3K9me binding | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 1136_1138 | 7.0 | 809.0 | Region | Note=S-adenosyl-L-methionine binding | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 1200_1201 | 7.0 | 809.0 | Region | Note=S-adenosyl-L-methionine binding | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 905_907 | 7.0 | 809.0 | Region | Note=Histone H3K9me binding | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 737_766 | 0 | 826.0 | Repeat | Note=ANK 1 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 772_801 | 0 | 826.0 | Repeat | Note=ANK 2 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 805_834 | 0 | 826.0 | Repeat | Note=ANK 3 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 838_868 | 0 | 826.0 | Repeat | Note=ANK 4 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 872_901 | 0 | 826.0 | Repeat | Note=ANK 5 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 905_934 | 0 | 826.0 | Repeat | Note=ANK 6 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 938_967 | 0 | 826.0 | Repeat | Note=ANK 7 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000334856 | 0 | 17 | 971_1004 | 0 | 826.0 | Repeat | Note=ANK 8 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 737_766 | 7.0 | 1299.0 | Repeat | Note=ANK 1 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 772_801 | 7.0 | 1299.0 | Repeat | Note=ANK 2 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 805_834 | 7.0 | 1299.0 | Repeat | Note=ANK 3 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 838_868 | 7.0 | 1299.0 | Repeat | Note=ANK 4 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 872_901 | 7.0 | 1299.0 | Repeat | Note=ANK 5 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 905_934 | 7.0 | 1299.0 | Repeat | Note=ANK 6 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 938_967 | 7.0 | 1299.0 | Repeat | Note=ANK 7 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000460843 | 0 | 27 | 971_1004 | 7.0 | 1299.0 | Repeat | Note=ANK 8 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 737_766 | 7.0 | 809.0 | Repeat | Note=ANK 1 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 772_801 | 7.0 | 809.0 | Repeat | Note=ANK 2 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 805_834 | 7.0 | 809.0 | Repeat | Note=ANK 3 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 838_868 | 7.0 | 809.0 | Repeat | Note=ANK 4 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 872_901 | 7.0 | 809.0 | Repeat | Note=ANK 5 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 905_934 | 7.0 | 809.0 | Repeat | Note=ANK 6 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 938_967 | 7.0 | 809.0 | Repeat | Note=ANK 7 | |
| Tgene | EHMT1 | chr6:36063843 | chr9:140605419 | ENST00000462484 | 0 | 16 | 971_1004 | 7.0 | 809.0 | Repeat | Note=ANK 8 |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | MAPK14 | chr6:36063843 | chr9:140605419 | ENST00000229794 | - | 9 | 12 | 24_308 | 254.0 | 361.0 | Domain | Protein kinase |
| Hgene | MAPK14 | chr6:36063843 | chr9:140605419 | ENST00000229795 | - | 1 | 12 | 24_308 | 0 | 361.0 | Domain | Protein kinase |
| Hgene | MAPK14 | chr6:36063843 | chr9:140605419 | ENST00000310795 | - | 9 | 11 | 24_308 | 254.0 | 312.6666666666667 | Domain | Protein kinase |
| Hgene | MAPK14 | chr6:36063843 | chr9:140605419 | ENST00000229795 | - | 1 | 12 | 30_38 | 0 | 361.0 | Nucleotide binding | Note=ATP |
| Hgene | MAPK14 | chr6:36063843 | chr9:140605419 | ENST00000229795 | - | 1 | 12 | 106_110 | 0 | 361.0 | Region | Note=Inhibitor-binding |
| Hgene | MAPK14 | chr6:36063843 | chr9:140605419 | ENST00000229795 | - | 1 | 12 | 168_169 | 0 | 361.0 | Region | Note=Inhibitor-binding |
| Hgene | MAPK14 | chr6:36063843 | chr9:140605419 | ENST00000229795 | - | 1 | 12 | 70_71 | 0 | 361.0 | Region | Note=Inhibitor-binding |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| MAPK14 | |
| EHMT1 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to MAPK14-EHMT1 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to MAPK14-EHMT1 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies