| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:MAPKAPK2-SRGAP2 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: MAPKAPK2-SRGAP2 | FusionPDB ID: 51612 | FusionGDB2.0 ID: 51612 | Hgene | Tgene | Gene symbol | MAPKAPK2 | SRGAP2 | Gene ID | 9261 | 23380 |
| Gene name | MAPK activated protein kinase 2 | SLIT-ROBO Rho GTPase activating protein 2 | |
| Synonyms | MAPKAP-K2|MK-2|MK2 | ARHGAP34|FNBP2|SRGAP2A|SRGAP3 | |
| Cytomap | 1q32.1 | 1q32.1 | |
| Type of gene | protein-coding | protein-coding | |
| Description | MAP kinase-activated protein kinase 2MAPKAP kinase 2mitogen-activated protein kinase-activated protein kinase 2 | SLIT-ROBO Rho GTPase-activating protein 2SLIT-ROBO GAP2formin-binding protein 2rho GTPase-activating protein 34 | |
| Modification date | 20200327 | 20200313 | |
| UniProtAcc | P49137 | . | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000294981, ENST00000367103, ENST00000479009, | ENST00000419187, ENST00000471256, ENST00000414007, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 8 X 6 X 5=240 | 15 X 15 X 7=1575 |
| # samples | 8 | 16 | |
| ** MAII score | log2(8/240*10)=-1.58496250072116 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(16/1575*10)=-3.29920801838728 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: MAPKAPK2 [Title/Abstract] AND SRGAP2 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | MAPKAPK2(206858853)-SRGAP2(206589249), # samples:2 SRGAP2(206135293)-MAPKAPK2(206904483), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | MAPKAPK2-SRGAP2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MAPKAPK2-SRGAP2 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. MAPKAPK2-SRGAP2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. MAPKAPK2-SRGAP2 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | MAPKAPK2 | GO:0018105 | peptidyl-serine phosphorylation | 15850461 |
| Hgene | MAPKAPK2 | GO:0032680 | regulation of tumor necrosis factor production | 15014438 |
| Hgene | MAPKAPK2 | GO:0034097 | response to cytokine | 8774846 |
| Hgene | MAPKAPK2 | GO:0070935 | 3'-UTR-mediated mRNA stabilization | 14517288|15014438|20932473 |
| Tgene | SRGAP2 | GO:0043547 | positive regulation of GTPase activity | 21148482 |
| Tgene | SRGAP2 | GO:0046847 | filopodium assembly | 22559944 |
| Tgene | SRGAP2 | GO:0051014 | actin filament severing | 21148482 |
| Tgene | SRGAP2 | GO:0060996 | dendritic spine development | 22559944 |
| Tgene | SRGAP2 | GO:2001223 | negative regulation of neuron migration | 22559944 |
| Fusion gene breakpoints across MAPKAPK2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across SRGAP2 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | HNSC | TCGA-CV-5435-01A | MAPKAPK2 | chr1 | 206858853 | - | SRGAP2 | chr1 | 206589249 | + |
| ChimerDB4 | HNSC | TCGA-CV-5435 | MAPKAPK2 | chr1 | 206858853 | + | SRGAP2 | chr1 | 206589249 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000294981 | MAPKAPK2 | chr1 | 206858853 | + | ENST00000414007 | SRGAP2 | chr1 | 206589249 | + | 5443 | 565 | 142 | 2424 | 760 |
| ENST00000367103 | MAPKAPK2 | chr1 | 206858853 | + | ENST00000414007 | SRGAP2 | chr1 | 206589249 | + | 5350 | 472 | 49 | 2331 | 760 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000294981 | ENST00000414007 | MAPKAPK2 | chr1 | 206858853 | + | SRGAP2 | chr1 | 206589249 | + | 0.001428217 | 0.99857175 |
| ENST00000367103 | ENST00000414007 | MAPKAPK2 | chr1 | 206858853 | + | SRGAP2 | chr1 | 206589249 | + | 0.001458517 | 0.9985415 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >51612_51612_1_MAPKAPK2-SRGAP2_MAPKAPK2_chr1_206858853_ENST00000294981_SRGAP2_chr1_206589249_ENST00000414007_length(amino acids)=760AA_BP=139 MEPGRVGEAGSSPERTSQPVGGRRGGGPEPEEGAAAGTPACAPASPGTMLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQ FPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKKMKEYLEGRNLITKLQAKHDLLQKTLGESQRTDCSLARR SSTVRKQDSSQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAFERGEDPLAGDQNDHDMDSIAGVLKLYFRGLEHPLFPKDI FHDLMACVTMDNLQERALHIRKVLLVLPKTTLIIMRYLFAFLNHLSQFSEENMMDPYNLAICFGPSLMSVPEGHDQVSCQAHVNELIKTI IIQHENIFPSPRELEGPVYSRGGSMEDYCDSPHGETTSVEDSTQDVTAEHHTSDDECEPIEAIAKFDYVGRTARELSFKKGASLLLYQRA SDDWWEGRHNGIDGLIPHQYIVVQDTEDGVVERSSPKSEIEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQRKRPESGSIRKTFR SDSHGLSSSLTDSSSPGVGASCRPSSQPIMSQSLPKEGPDKCSISGHGSLNSISRHSSLKNRLDSPQIRKTATAGRSKSFNNHRPMDPEV IAQDIEATMNSALNELRELERQSSVKHTPDVVLDTLEPLKTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGDIACAFRPVKSVKMA -------------------------------------------------------------- >51612_51612_2_MAPKAPK2-SRGAP2_MAPKAPK2_chr1_206858853_ENST00000367103_SRGAP2_chr1_206589249_ENST00000414007_length(amino acids)=760AA_BP=139 MEPGRVGEAGSSPERTSQPVGGRRGGGPEPEEGAAAGTPACAPASPGTMLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQ FPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKKMKEYLEGRNLITKLQAKHDLLQKTLGESQRTDCSLARR SSTVRKQDSSQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAFERGEDPLAGDQNDHDMDSIAGVLKLYFRGLEHPLFPKDI FHDLMACVTMDNLQERALHIRKVLLVLPKTTLIIMRYLFAFLNHLSQFSEENMMDPYNLAICFGPSLMSVPEGHDQVSCQAHVNELIKTI IIQHENIFPSPRELEGPVYSRGGSMEDYCDSPHGETTSVEDSTQDVTAEHHTSDDECEPIEAIAKFDYVGRTARELSFKKGASLLLYQRA SDDWWEGRHNGIDGLIPHQYIVVQDTEDGVVERSSPKSEIEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQRKRPESGSIRKTFR SDSHGLSSSLTDSSSPGVGASCRPSSQPIMSQSLPKEGPDKCSISGHGSLNSISRHSSLKNRLDSPQIRKTATAGRSKSFNNHRPMDPEV IAQDIEATMNSALNELRELERQSSVKHTPDVVLDTLEPLKTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGDIACAFRPVKSVKMA -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:206858853/chr1:206589249) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| MAPKAPK2 | . |
| FUNCTION: Stress-activated serine/threonine-protein kinase involved in cytokine production, endocytosis, reorganization of the cytoskeleton, cell migration, cell cycle control, chromatin remodeling, DNA damage response and transcriptional regulation. Following stress, it is phosphorylated and activated by MAP kinase p38-alpha/MAPK14, leading to phosphorylation of substrates. Phosphorylates serine in the peptide sequence, Hyd-X-R-X(2)-S, where Hyd is a large hydrophobic residue. Phosphorylates ALOX5, CDC25B, CDC25C, CEP131, ELAVL1, HNRNPA0, HSP27/HSPB1, KRT18, KRT20, LIMK1, LSP1, PABPC1, PARN, PDE4A, RCSD1, RPS6KA3, TAB3 and TTP/ZFP36. Phosphorylates HSF1; leading to the interaction with HSP90 proteins and inhibiting HSF1 homotrimerization, DNA-binding and transactivation activities (PubMed:16278218). Mediates phosphorylation of HSP27/HSPB1 in response to stress, leading to the dissociation of HSP27/HSPB1 from large small heat-shock protein (sHsps) oligomers and impairment of their chaperone activities and ability to protect against oxidative stress effectively. Involved in inflammatory response by regulating tumor necrosis factor (TNF) and IL6 production post-transcriptionally: acts by phosphorylating AU-rich elements (AREs)-binding proteins ELAVL1, HNRNPA0, PABPC1 and TTP/ZFP36, leading to the regulation of the stability and translation of TNF and IL6 mRNAs. Phosphorylation of TTP/ZFP36, a major post-transcriptional regulator of TNF, promotes its binding to 14-3-3 proteins and reduces its ARE mRNA affinity, leading to inhibition of dependent degradation of ARE-containing transcripts. Phosphorylates CEP131 in response to cellular stress induced by ultraviolet irradiation which promotes binding of CEP131 to 14-3-3 proteins and inhibits formation of novel centriolar satellites (PubMed:26616734). Also involved in late G2/M checkpoint following DNA damage through a process of post-transcriptional mRNA stabilization: following DNA damage, relocalizes from nucleus to cytoplasm and phosphorylates HNRNPA0 and PARN, leading to stabilization of GADD45A mRNA. Involved in toll-like receptor signaling pathway (TLR) in dendritic cells: required for acute TLR-induced macropinocytosis by phosphorylating and activating RPS6KA3. {ECO:0000269|PubMed:10383393, ECO:0000269|PubMed:11844797, ECO:0000269|PubMed:12456657, ECO:0000269|PubMed:12565831, ECO:0000269|PubMed:14499342, ECO:0000269|PubMed:14517288, ECO:0000269|PubMed:15014438, ECO:0000269|PubMed:15629715, ECO:0000269|PubMed:16278218, ECO:0000269|PubMed:16456544, ECO:0000269|PubMed:17481585, ECO:0000269|PubMed:18021073, ECO:0000269|PubMed:20932473, ECO:0000269|PubMed:26616734, ECO:0000269|PubMed:8093612, ECO:0000269|PubMed:8280084, ECO:0000269|PubMed:8774846}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000294981 | + | 1 | 10 | 10_40 | 93.0 | 371.0 | Compositional bias | Note=Pro-rich |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000294981 | + | 1 | 10 | 35_40 | 93.0 | 371.0 | Compositional bias | Note=Poly-Pro |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000367103 | + | 1 | 10 | 10_40 | 93.0 | 401.0 | Compositional bias | Note=Pro-rich |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000367103 | + | 1 | 10 | 35_40 | 93.0 | 401.0 | Compositional bias | Note=Poly-Pro |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000294981 | + | 1 | 10 | 70_78 | 93.0 | 371.0 | Nucleotide binding | ATP |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000367103 | + | 1 | 10 | 70_78 | 93.0 | 401.0 | Nucleotide binding | ATP |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000294981 | + | 1 | 10 | 64_325 | 93.0 | 371.0 | Domain | Protein kinase |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000367103 | + | 1 | 10 | 64_325 | 93.0 | 401.0 | Domain | Protein kinase |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000294981 | + | 1 | 10 | 356_365 | 93.0 | 371.0 | Motif | Note=Nuclear export signal (NES) |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000294981 | + | 1 | 10 | 371_374 | 93.0 | 371.0 | Motif | Note=Bipartite nuclear localization signal 1 |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000294981 | + | 1 | 10 | 385_389 | 93.0 | 371.0 | Motif | Note=Bipartite nuclear localization signal 2 |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000367103 | + | 1 | 10 | 356_365 | 93.0 | 401.0 | Motif | Note=Nuclear export signal (NES) |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000367103 | + | 1 | 10 | 371_374 | 93.0 | 401.0 | Motif | Note=Bipartite nuclear localization signal 1 |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000367103 | + | 1 | 10 | 385_389 | 93.0 | 401.0 | Motif | Note=Bipartite nuclear localization signal 2 |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000294981 | + | 1 | 10 | 139_141 | 93.0 | 371.0 | Region | Note=Staurosporine binding |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000294981 | + | 1 | 10 | 328_364 | 93.0 | 371.0 | Region | Autoinhibitory helix |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000294981 | + | 1 | 10 | 366_390 | 93.0 | 371.0 | Region | Note=p38 MAPK-binding site |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000367103 | + | 1 | 10 | 139_141 | 93.0 | 401.0 | Region | Note=Staurosporine binding |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000367103 | + | 1 | 10 | 328_364 | 93.0 | 401.0 | Region | Autoinhibitory helix |
| Hgene | MAPKAPK2 | chr1:206858853 | chr1:206589249 | ENST00000367103 | + | 1 | 10 | 366_390 | 93.0 | 401.0 | Region | Note=p38 MAPK-binding site |
Top |
Fusion Protein Structures |
| PDB and CIF files of the predicted fusion proteins * Here we show the 3D structure of the fusion proteins using Mol*. AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. Model confidence is shown from the pLDDT values per residue. pLDDT corresponds to the model’s prediction of its score on the local Distance Difference Test. It is a measure of local accuracy (from AlphfaFold website). To color code individual residues, we transformed individual PDB files into CIF format. |
| Fusion protein PDB link (fusion AA seq ID in FusionPDB) | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | AA seq | Len(AA seq) |
| PDB file >>>1531_MAPKAPK2_206858853_SRGAP2_206589249_ranked_0.pdb | MAPKAPK2 | 206858853 | 206858853 | ENST00000414007 | SRGAP2 | chr1 | 206589249 | + | MEPGRVGEAGSSPERTSQPVGGRRGGGPEPEEGAAAGTPACAPASPGTMLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQ FPQFHVKSGLQIKKNAIIDDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKKMKEYLEGRNLITKLQAKHDLLQKTLGESQRTDCSLARR SSTVRKQDSSQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKNAFERGEDPLAGDQNDHDMDSIAGVLKLYFRGLEHPLFPKDI FHDLMACVTMDNLQERALHIRKVLLVLPKTTLIIMRYLFAFLNHLSQFSEENMMDPYNLAICFGPSLMSVPEGHDQVSCQAHVNELIKTI IIQHENIFPSPRELEGPVYSRGGSMEDYCDSPHGETTSVEDSTQDVTAEHHTSDDECEPIEAIAKFDYVGRTARELSFKKGASLLLYQRA SDDWWEGRHNGIDGLIPHQYIVVQDTEDGVVERSSPKSEIEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQRKRPESGSIRKTFR SDSHGLSSSLTDSSSPGVGASCRPSSQPIMSQSLPKEGPDKCSISGHGSLNSISRHSSLKNRLDSPQIRKTATAGRSKSFNNHRPMDPEV IAQDIEATMNSALNELRELERQSSVKHTPDVVLDTLEPLKTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGDIACAFRPVKSVKMA | 760 |
Top |
pLDDT score distribution |
| pLDDT score distribution of the predicted wild-type structures of two partner proteins from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
MAPKAPK2_pLDDT.png  |
SRGAP2_pLDDT.png  |
| pLDDT score distribution of the predicted fusion protein structures from AlphaFold2 * AlphaFold produces a per-residue confidence score (pLDDT) between 0 and 100. |
 |
Top |
Ramachandran Plot of Fusion Protein Structure |
| Ramachandran plot of the torsional angles - phi (φ)and psi (ψ) - of the residues (amino acids) contained in this fusion protein peptide. |
| Fusion AA seq ID in FusionPDB and their Ramachandran plots |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| MAPKAPK2 | |
| SRGAP2 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to MAPKAPK2-SRGAP2 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to MAPKAPK2-SRGAP2 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies