UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
![]() |
|||||||
|
Fusion Protein:NAGLU-SH3GL1 |
Fusion Protein Summary |
![]() |
Fusion partner gene information | Fusion gene name: NAGLU-SH3GL1 | FusionPDB ID: 57148 | FusionGDB2.0 ID: 57148 | Hgene | Tgene | Gene symbol | NAGLU | SH3GL1 | Gene ID | 4669 | 6455 |
Gene name | N-acetyl-alpha-glucosaminidase | SH3 domain containing GRB2 like 1, endophilin A2 | |
Synonyms | CMT2V|MPS-IIIB|MPS3B|NAG|UFHSD | CNSA1|EEN|SH3D2B|SH3P8 | |
Cytomap | 17q21.2 | 19p13.3 | |
Type of gene | protein-coding | protein-coding | |
Description | alpha-N-acetylglucosaminidaseN-acetylglucosaminidase, alphatesticular tissue protein Li 18 | endophilin-A2EEN fusion partner of MLLSH3 domain protein 2BSH3 domain-containing GRB2-like protein 1SH3-containing Grb-2-like 1 proteinSH3-domain GRB2-like 1endophilin-2extra 11-19 leukemia fusionextra eleven-nineteen leukemia fusion gene protein | |
Modification date | 20200313 | 20200313 | |
UniProtAcc | P54802 | Q99961 | |
Ensembl transtripts involved in fusion gene | ENST ids | ENST00000225927, | ENST00000417295, ENST00000598564, ENST00000269886, |
Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 4 X 4 X 3=48 | 10 X 6 X 9=540 |
# samples | 4 | 10 | |
** MAII score | log2(4/48*10)=-0.263034405833794 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | log2(10/540*10)=-2.43295940727611 possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs). DoF>8 and MAII<0 | |
Context (manual curation of fusion genes in FusionPDB) | PubMed: NAGLU [Title/Abstract] AND SH3GL1 [Title/Abstract] AND fusion [Title/Abstract] | ||
Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | NAGLU(40693224)-SH3GL1(4364218), # samples:1 | ||
Anticipated loss of major functional domain due to fusion event. | NAGLU-SH3GL1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. NAGLU-SH3GL1 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. NAGLU-SH3GL1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. NAGLU-SH3GL1 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. |
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
![]() |
Partner | Gene | GO ID | GO term | PubMed ID |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
![]() * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
![]() |
Top |
Fusion Gene Sample Information |
![]() |
![]() * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
ChimerDB4 | LUSC | TCGA-21-1072 | NAGLU | chr17 | 40693224 | + | SH3GL1 | chr19 | 4364218 | - |
Top |
Fusion ORF Analysis |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
ENST00000225927 | NAGLU | chr17 | 40693224 | + | ENST00000269886 | SH3GL1 | chr19 | 4364218 | - | 3128 | 1122 | 101 | 1897 | 598 |
![]() |
Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
ENST00000225927 | ENST00000269886 | NAGLU | chr17 | 40693224 | + | SH3GL1 | chr19 | 4364218 | - | 0.00823013 | 0.9917699 |
Top |
Fusion Amino Acid Sequences |
![]() |
>FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >57148_57148_1_NAGLU-SH3GL1_NAGLU_chr17_40693224_ENST00000225927_SH3GL1_chr19_4364218_ENST00000269886_length(amino acids)=598AA_BP=340 MEAVAVAAAVGVLLLAGAGGAAGDEAREAAAVRALVARLLGPGPAADFSVSVERALAAKPGLDTYSLGGGGAARVRVRGSTGVAAAAGLH RYLRDFCGCHVAWSGSQLRLPRPLPAVPGELTEATPNRYRYYQNVCTQSYSFVWWDWARWEREIDWMALNGINLALAWSGQEAIWQRVYL ALGLTQAEINEFFTGPAFLAWGRMGNLHTWDGPLPPSWHIKQLYLQHRVLDQMRSFGMTPVLPAFAGHVPEAVTRVFPQVNVTKMGSWGH FNCSYSCSFLLAPEDPIFPIIGSLFLRELIKEFGTDHIYGADTFNEMQPPSSEPSYLAAATTAVYEAMTAGDALLDAGESMKRLAEVKDS LDIEVKQNFIDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVD AQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPS -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
![]() Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr17:40693224/chr19:4364218) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
![]() |
![]() |
Hgene | Tgene |
NAGLU | SH3GL1 |
FUNCTION: Involved in the degradation of heparan sulfate. | FUNCTION: Implicated in endocytosis. May recruit other proteins to membranes with high curvature (By similarity). {ECO:0000250}. |
![]() |
- Retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Hgene | NAGLU | chr17:40693224 | chr19:4364218 | ENST00000225927 | + | 5 | 6 | 68_71 | 340.3333333333333 | 744.0 | Compositional bias | Note=Poly-Gly |
Hgene | NAGLU | chr17:40693224 | chr19:4364218 | ENST00000225927 | + | 5 | 6 | 84_87 | 340.3333333333333 | 744.0 | Compositional bias | Note=Poly-Ala |
Tgene | SH3GL1 | chr17:40693224 | chr19:4364218 | ENST00000269886 | 3 | 10 | 145_250 | 110.33333333333333 | 369.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | SH3GL1 | chr17:40693224 | chr19:4364218 | ENST00000417295 | 2 | 9 | 145_250 | 62.333333333333336 | 321.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | SH3GL1 | chr17:40693224 | chr19:4364218 | ENST00000598564 | 0 | 10 | 145_250 | 0 | 305.0 | Coiled coil | Ontology_term=ECO:0000255 | |
Tgene | SH3GL1 | chr17:40693224 | chr19:4364218 | ENST00000269886 | 3 | 10 | 306_365 | 110.33333333333333 | 369.0 | Domain | SH3 | |
Tgene | SH3GL1 | chr17:40693224 | chr19:4364218 | ENST00000417295 | 2 | 9 | 306_365 | 62.333333333333336 | 321.0 | Domain | SH3 | |
Tgene | SH3GL1 | chr17:40693224 | chr19:4364218 | ENST00000598564 | 0 | 10 | 18_249 | 0 | 305.0 | Domain | BAR | |
Tgene | SH3GL1 | chr17:40693224 | chr19:4364218 | ENST00000598564 | 0 | 10 | 306_365 | 0 | 305.0 | Domain | SH3 | |
Tgene | SH3GL1 | chr17:40693224 | chr19:4364218 | ENST00000417295 | 2 | 9 | 60_87 | 62.333333333333336 | 321.0 | Region | Required for dimerization upon membrane association | |
Tgene | SH3GL1 | chr17:40693224 | chr19:4364218 | ENST00000598564 | 0 | 10 | 1_21 | 0 | 305.0 | Region | Membrane-binding amphipathic helix | |
Tgene | SH3GL1 | chr17:40693224 | chr19:4364218 | ENST00000598564 | 0 | 10 | 60_87 | 0 | 305.0 | Region | Required for dimerization upon membrane association |
- Not-retained protein feature among the 13 regional features. |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
Tgene | SH3GL1 | chr17:40693224 | chr19:4364218 | ENST00000269886 | 3 | 10 | 18_249 | 110.33333333333333 | 369.0 | Domain | BAR | |
Tgene | SH3GL1 | chr17:40693224 | chr19:4364218 | ENST00000417295 | 2 | 9 | 18_249 | 62.333333333333336 | 321.0 | Domain | BAR | |
Tgene | SH3GL1 | chr17:40693224 | chr19:4364218 | ENST00000269886 | 3 | 10 | 1_21 | 110.33333333333333 | 369.0 | Region | Membrane-binding amphipathic helix | |
Tgene | SH3GL1 | chr17:40693224 | chr19:4364218 | ENST00000269886 | 3 | 10 | 60_87 | 110.33333333333333 | 369.0 | Region | Required for dimerization upon membrane association | |
Tgene | SH3GL1 | chr17:40693224 | chr19:4364218 | ENST00000417295 | 2 | 9 | 1_21 | 62.333333333333336 | 321.0 | Region | Membrane-binding amphipathic helix |
Top |
Fusion Protein-Protein Interaction |
![]() |
![]() |
Gene | PPI interactors |
![]() |
Gene | STRING network |
NAGLU | |
SH3GL1 | ![]() |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
![]() |
Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
Top |
Related Drugs to NAGLU-SH3GL1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to NAGLU-SH3GL1 |
![]() (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
Hgene | Tgene | Disease | Source | PMID |
![]() (DisGeNet 4.0) |
Partner | Gene | Disease ID | Disease name | # pubmeds | Source |