| UTHEALTH HOME ABOUT SBMI A-Z WEBMAIL INSIDE THE UNIVERSITY |
|
|||||||
|
Fusion Protein:NEK2-METTL13 |
Fusion Protein Summary |
 Fusion gene summary |
| Fusion partner gene information | Fusion gene name: NEK2-METTL13 | FusionPDB ID: 58512 | FusionGDB2.0 ID: 58512 | Hgene | Tgene | Gene symbol | NEK2 | METTL13 | Gene ID | 4751 | 51603 |
| Gene name | NIMA related kinase 2 | eEF1A lysine and N-terminal methyltransferase | |
| Synonyms | HsPK21|NEK2A|NLK1|PPP1R111|RP67 | 5630401D24Rik|CGI-01|DFNB26|DFNB26M|DFNM1|KIAA0859|METTL13|feat | |
| Cytomap | 1q32.3 | 1q24.3 | |
| Type of gene | protein-coding | protein-coding | |
| Description | serine/threonine-protein kinase Nek2NIMA (never in mitosis gene a)-related kinase 2nimA-like protein kinase 1nimA-related protein kinase 2protein phosphatase 1, regulatory subunit 111 | eEF1A lysine and N-terminal methyltransferaseantiapoptotic protein FEATdeafness (autosomal recessive, nonsyndromic) modifier 1deafness (recessive, non-syndromic) modifier 1deafness (recessive, nonsyndromic) modifier 1eEF1A-KNMTmethyltransferase like | |
| Modification date | 20200313 | 20200313 | |
| UniProtAcc | P51955 | . | |
| Ensembl transtripts involved in fusion gene | ENST ids | ENST00000366999, ENST00000540251, ENST00000462283, ENST00000366998, | ENST00000466643, ENST00000361735, ENST00000362019, ENST00000367737, ENST00000458517, |
| Fusion gene scores for assessment (based on all fusion genes of FusionGDB 2.0) | * DoF score | 2 X 2 X 2=8 | 2 X 2 X 2=8 |
| # samples | 2 | 2 | |
| ** MAII score | log2(2/8*10)=1.32192809488736 | log2(2/8*10)=1.32192809488736 | |
| Context (manual curation of fusion genes in FusionPDB) | PubMed: NEK2 [Title/Abstract] AND METTL13 [Title/Abstract] AND fusion [Title/Abstract] | ||
| Most frequent breakpoint (based on all fusion genes of FusionGDB 2.0) | NEK2(211840447)-METTL13(171761156), # samples:1 | ||
| Anticipated loss of major functional domain due to fusion event. | NEK2-METTL13 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. NEK2-METTL13 seems lost the major protein functional domain in Hgene partner, which is a CGC by not retaining the major functional domain in the partially deleted in-frame ORF. NEK2-METTL13 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. NEK2-METTL13 seems lost the major protein functional domain in Hgene partner, which is a essential gene by not retaining the major functional domain in the partially deleted in-frame ORF. | ||
| * DoF score (Degree of Frequency) = # partners X # break points X # cancer types ** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10) |
| Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Partner | Gene | GO ID | GO term | PubMed ID |
| Hgene | NEK2 | GO:0006468 | protein phosphorylation | 21076410 |
| Hgene | NEK2 | GO:0007059 | chromosome segregation | 14978040 |
| Hgene | NEK2 | GO:0046777 | protein autophosphorylation | 17626005 |
| Hgene | NEK2 | GO:0051299 | centrosome separation | 18086858 |
| Fusion gene breakpoints across NEK2 (5'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
| Fusion gene breakpoints across METTL13 (3'-gene) * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Fusion Gene Sample Information |
| Fusion gene information from FusionGDB2.0. |
| Fusion gene information from two resources (ChiTars 5.0 and ChimerDB 4.0) * All genome coordinats were lifted-over on hg19. * Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser. |
| Source | Disease | Sample | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand |
| ChimerDB4 | CESC | TCGA-DR-A0ZL | NEK2 | chr1 | 211840447 | - | METTL13 | chr1 | 171761156 | + |
Top |
Fusion ORF Analysis |
| Fusion information from ORFfinder translation from full-length transcript sequence from FusionPDB. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | Seq length (transcript) | BP loci (transcript) | Predicted start (transcript) | Predicted stop (transcript) | Seq length (amino acids) |
| ENST00000366999 | NEK2 | chr1 | 211840447 | - | ENST00000458517 | METTL13 | chr1 | 171761156 | + | 2081 | 1250 | 31 | 1875 | 614 |
| ENST00000366999 | NEK2 | chr1 | 211840447 | - | ENST00000362019 | METTL13 | chr1 | 171761156 | + | 2837 | 1250 | 31 | 1875 | 614 |
| ENST00000366999 | NEK2 | chr1 | 211840447 | - | ENST00000367737 | METTL13 | chr1 | 171761156 | + | 2837 | 1250 | 31 | 1875 | 614 |
| ENST00000366999 | NEK2 | chr1 | 211840447 | - | ENST00000361735 | METTL13 | chr1 | 171761156 | + | 2837 | 1250 | 31 | 1875 | 614 |
| ENST00000540251 | NEK2 | chr1 | 211840447 | - | ENST00000458517 | METTL13 | chr1 | 171761156 | + | 1958 | 1127 | 4 | 1752 | 582 |
| ENST00000540251 | NEK2 | chr1 | 211840447 | - | ENST00000362019 | METTL13 | chr1 | 171761156 | + | 2714 | 1127 | 4 | 1752 | 582 |
| ENST00000540251 | NEK2 | chr1 | 211840447 | - | ENST00000367737 | METTL13 | chr1 | 171761156 | + | 2714 | 1127 | 4 | 1752 | 582 |
| ENST00000540251 | NEK2 | chr1 | 211840447 | - | ENST00000361735 | METTL13 | chr1 | 171761156 | + | 2714 | 1127 | 4 | 1752 | 582 |
| DeepORF prediction of the coding potential based on the fusion transcript sequence of in-frame fusion genes. DeepORF is a coding potential classifier based on convolutional neural network by comparing the real Ribo-seq data. If the no-coding score < 0.5 and coding score > 0.5, then the in-frame fusion transcript is predicted as being likely translated. |
| Henst | Tenst | Hgene | Hchr | Hbp | Hstrand | Tgene | Tchr | Tbp | Tstrand | No-coding score | Coding score |
| ENST00000366999 | ENST00000458517 | NEK2 | chr1 | 211840447 | - | METTL13 | chr1 | 171761156 | + | 0.002365168 | 0.99763477 |
| ENST00000366999 | ENST00000362019 | NEK2 | chr1 | 211840447 | - | METTL13 | chr1 | 171761156 | + | 0.001003303 | 0.9989967 |
| ENST00000366999 | ENST00000367737 | NEK2 | chr1 | 211840447 | - | METTL13 | chr1 | 171761156 | + | 0.001003303 | 0.9989967 |
| ENST00000366999 | ENST00000361735 | NEK2 | chr1 | 211840447 | - | METTL13 | chr1 | 171761156 | + | 0.001003303 | 0.9989967 |
| ENST00000540251 | ENST00000458517 | NEK2 | chr1 | 211840447 | - | METTL13 | chr1 | 171761156 | + | 0.001307502 | 0.9986926 |
| ENST00000540251 | ENST00000362019 | NEK2 | chr1 | 211840447 | - | METTL13 | chr1 | 171761156 | + | 0.000542437 | 0.99945754 |
| ENST00000540251 | ENST00000367737 | NEK2 | chr1 | 211840447 | - | METTL13 | chr1 | 171761156 | + | 0.000542437 | 0.99945754 |
| ENST00000540251 | ENST00000361735 | NEK2 | chr1 | 211840447 | - | METTL13 | chr1 | 171761156 | + | 0.000542437 | 0.99945754 |
Top |
Fusion Amino Acid Sequences |
| For individual full-length fusion transcript sequence from FusionPDB, we ran ORFfinder and chose the longest ORF among the all predicted ones. |
| >FusionGDB ID_FusionGDB isoform ID_FGname_Hgene_Hchr_Hbp_Henst_Tgene_Tchr_Tbp_Tenst_length(fusion AA) seq_BP >58512_58512_1_NEK2-METTL13_NEK2_chr1_211840447_ENST00000366999_METTL13_chr1_171761156_ENST00000361735_length(amino acids)=614AA_BP=395 MLGGFSIQVPGVPGPWSSALGGATCVRQRDSGDWPAMPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVS EVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKP ANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR RIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSSPVLSELKLKEIQLQERERALKARE ERLEQKEQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQ WFGFSQSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDS -------------------------------------------------------------- >58512_58512_2_NEK2-METTL13_NEK2_chr1_211840447_ENST00000366999_METTL13_chr1_171761156_ENST00000362019_length(amino acids)=614AA_BP=395 MLGGFSIQVPGVPGPWSSALGGATCVRQRDSGDWPAMPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVS EVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKP ANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR RIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSSPVLSELKLKEIQLQERERALKARE ERLEQKEQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQ WFGFSQSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDS -------------------------------------------------------------- >58512_58512_3_NEK2-METTL13_NEK2_chr1_211840447_ENST00000366999_METTL13_chr1_171761156_ENST00000367737_length(amino acids)=614AA_BP=395 MLGGFSIQVPGVPGPWSSALGGATCVRQRDSGDWPAMPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVS EVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKP ANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR RIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSSPVLSELKLKEIQLQERERALKARE ERLEQKEQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQ WFGFSQSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDS -------------------------------------------------------------- >58512_58512_4_NEK2-METTL13_NEK2_chr1_211840447_ENST00000366999_METTL13_chr1_171761156_ENST00000458517_length(amino acids)=614AA_BP=395 MLGGFSIQVPGVPGPWSSALGGATCVRQRDSGDWPAMPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVS EVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKP ANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR RIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSSPVLSELKLKEIQLQERERALKARE ERLEQKEQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQ WFGFSQSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDS -------------------------------------------------------------- >58512_58512_5_NEK2-METTL13_NEK2_chr1_211840447_ENST00000540251_METTL13_chr1_171761156_ENST00000361735_length(amino acids)=582AA_BP=363 MLGGFSIQVPGVPGPWSSALGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVM EYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTF VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEIL ENPLIADLVADEQRRNLERRGRQLGEPEKSQDSSPVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAENLLKNYS LLKERKFLSLASNPEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQWFGFSQSDRMKVHIADGLDYIASLAGGGEARP CYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPE -------------------------------------------------------------- >58512_58512_6_NEK2-METTL13_NEK2_chr1_211840447_ENST00000540251_METTL13_chr1_171761156_ENST00000362019_length(amino acids)=582AA_BP=363 MLGGFSIQVPGVPGPWSSALGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVM EYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTF VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEIL ENPLIADLVADEQRRNLERRGRQLGEPEKSQDSSPVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAENLLKNYS LLKERKFLSLASNPEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQWFGFSQSDRMKVHIADGLDYIASLAGGGEARP CYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPE -------------------------------------------------------------- >58512_58512_7_NEK2-METTL13_NEK2_chr1_211840447_ENST00000540251_METTL13_chr1_171761156_ENST00000367737_length(amino acids)=582AA_BP=363 MLGGFSIQVPGVPGPWSSALGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVM EYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTF VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEIL ENPLIADLVADEQRRNLERRGRQLGEPEKSQDSSPVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAENLLKNYS LLKERKFLSLASNPEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQWFGFSQSDRMKVHIADGLDYIASLAGGGEARP CYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPE -------------------------------------------------------------- >58512_58512_8_NEK2-METTL13_NEK2_chr1_211840447_ENST00000540251_METTL13_chr1_171761156_ENST00000458517_length(amino acids)=582AA_BP=363 MLGGFSIQVPGVPGPWSSALGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVM EYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTF VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEIL ENPLIADLVADEQRRNLERRGRQLGEPEKSQDSSPVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAENLLKNYS LLKERKFLSLASNPEIPLALLVVGLGGGSLPLFVHDHFPKSCIDAVEIDPSMLEVATQWFGFSQSDRMKVHIADGLDYIASLAGGGEARP CYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRIEGEVNEILFCQLHPE -------------------------------------------------------------- |
Top |
Fusion Protein Functional Features |
| Four levels of functional features of fusion genes Go to FGviewer search page for the most frequent breakpoint (https://ccsmweb.uth.edu/FGviewer/chr1:211840447/chr1:171761156) - FGviewer provides the online visualization of the retention search of the protein functional features across DNA, RNA, protein, and pathological levels. - How to search 1. Put your fusion gene symbol. 2. Press the tab key until there will be shown the breakpoint information filled. 4. Go down and press 'Search' tab twice. 4. Go down to have the hyperlink of the search result. 5. Click the hyperlink. 6. See the FGviewer result for your fusion gene. |
 |
| Main function of each fusion partner protein. (from UniProt) |
| Hgene | Tgene |
| NEK2 | . |
| FUNCTION: Protein kinase which is involved in the control of centrosome separation and bipolar spindle formation in mitotic cells and chromatin condensation in meiotic cells. Regulates centrosome separation (essential for the formation of bipolar spindles and high-fidelity chromosome separation) by phosphorylating centrosomal proteins such as CROCC, CEP250 and NINL, resulting in their displacement from the centrosomes. Regulates kinetochore microtubule attachment stability in mitosis via phosphorylation of NDC80. Involved in regulation of mitotic checkpoint protein complex via phosphorylation of CDC20 and MAD2L1. Plays an active role in chromatin condensation during the first meiotic division through phosphorylation of HMGA2. Phosphorylates: PPP1CC; SGO1; NECAB3 and NPM1. Essential for localization of MAD2L1 to kinetochore and MAPK1 and NPM1 to the centrosome. Phosphorylates CEP68 and CNTLN directly or indirectly (PubMed:24554434). NEK2-mediated phosphorylation of CEP68 promotes CEP68 dissociation from the centrosome and its degradation at the onset of mitosis (PubMed:25704143). Involved in the regulation of centrosome disjunction (PubMed:26220856). {ECO:0000269|PubMed:11742531, ECO:0000269|PubMed:12857871, ECO:0000269|PubMed:14978040, ECO:0000269|PubMed:15358203, ECO:0000269|PubMed:15388344, ECO:0000269|PubMed:17283141, ECO:0000269|PubMed:17621308, ECO:0000269|PubMed:17626005, ECO:0000269|PubMed:18086858, ECO:0000269|PubMed:18297113, ECO:0000269|PubMed:20034488, ECO:0000269|PubMed:21076410, ECO:0000269|PubMed:24554434, ECO:0000269|PubMed:25704143, ECO:0000269|PubMed:26220856}.; FUNCTION: [Isoform 1]: Phosphorylates and activates NEK11 in G1/S-arrested cells. {ECO:0000269|PubMed:15161910}.; FUNCTION: [Isoform 2]: Not present in the nucleolus and, in contrast to isoform 1, does not phosphorylate and activate NEK11 in G1/S-arrested cells. {ECO:0000269|PubMed:15161910}. | FUNCTION: Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes. |
| Retention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at * Minus value of BPloci means that the break pointn is located before the CDS. |
| - Retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366999 | - | 7 | 8 | 303_362 | 370.3333333333333 | 446.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366999 | - | 7 | 8 | 8_271 | 370.3333333333333 | 446.0 | Domain | Protein kinase |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366999 | - | 7 | 8 | 14_22 | 370.3333333333333 | 446.0 | Nucleotide binding | ATP |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366999 | - | 7 | 8 | 306_334 | 370.3333333333333 | 446.0 | Region | Note=Leucine-zipper |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366999 | - | 7 | 8 | 333_370 | 370.3333333333333 | 446.0 | Region | Note=Required for microtubule binding and for localization to the centrosomes |
| - Not-retained protein feature among the 13 regional features. |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Protein feature | Protein feature note |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366998 | - | 1 | 7 | 303_362 | 0 | 385.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366998 | - | 1 | 7 | 406_430 | 0 | 385.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366999 | - | 7 | 8 | 406_430 | 370.3333333333333 | 446.0 | Coiled coil | Ontology_term=ECO:0000255 |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366998 | - | 1 | 7 | 8_271 | 0 | 385.0 | Domain | Protein kinase |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366998 | - | 1 | 7 | 14_22 | 0 | 385.0 | Nucleotide binding | ATP |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366998 | - | 1 | 7 | 306_334 | 0 | 385.0 | Region | Note=Leucine-zipper |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366998 | - | 1 | 7 | 333_370 | 0 | 385.0 | Region | Note=Required for microtubule binding and for localization to the centrosomes |
Top |
Fusion Protein-Protein Interaction |
| Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in |
| Protein-protein interactors with each fusion partner protein in wild-type from validated records (BIOGRID-3.4.160) |
| Gene | PPI interactors |
| Protein-protein interactors based on sequence similarity (STRING) |
| Gene | STRING network |
| NEK2 | |
| METTL13 |
| - Retained interactions in fusion protein (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Still interaction with |
| - Lost interactions due to fusion (protein functional feature from UniProt). |
| Partner | Gene | Hbp | Tbp | ENST | Strand | BPexon | TotalExon | Protein feature loci | *BPloci | TotalLen | Interaction lost with |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366998 | - | 1 | 7 | 301_445 | 0 | 385.0 | CEP85 |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366999 | - | 7 | 8 | 301_445 | 370.3333333333333 | 446.0 | CEP85 |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366998 | - | 1 | 7 | 264_445 | 0 | 385.0 | PCNT |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366999 | - | 7 | 8 | 264_445 | 370.3333333333333 | 446.0 | PCNT |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366998 | - | 1 | 7 | 403_439 | 0 | 385.0 | SAV1 and STK3/MST2 |
| Hgene | NEK2 | chr1:211840447 | chr1:171761156 | ENST00000366999 | - | 7 | 8 | 403_439 | 370.3333333333333 | 446.0 | SAV1 and STK3/MST2 |
Top |
Related Drugs to NEK2-METTL13 |
| Drugs used for this fusion-positive patient. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Drug | Source | PMID |
Top |
Related Diseases to NEK2-METTL13 |
| Diseases that have this fusion gene. (Manual curation of PubMed, 04-30-2022 + MyCancerGenome) |
| Hgene | Tgene | Disease | Source | PMID |
| Diseases associated with fusion partners. (DisGeNet 4.0) |
| Partner | Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2021-Present -The University of Texas Health Science Center at Houston (UTHealth)
Web File Viewing | Emergency Information |Campus Carry|Site Policies